KEGG   Phoenix dactylifera (date palm): 103695658Help
Entry
103695658         CDS       T03274                                 

Definition
(RefSeq) GPI transamidase component PIG-T homolog
  KO
K05292  GPI-anchor transamidase subunit T
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    103695658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 103695658
NCBI-ProteinID: XP_026656404
UniProt: A0A3Q0HPM2
Position
Unknown
AA seq 566 aa AA seqDB search
MELSFTQGRWNYENWGGSDPMSSTNAKPPGVELWTLFDLPVTQVDATWKNLTHSLSGLFC
ASINFLESSTAYSAPRWGFHPNSDNLRYGALPREAVCTENLTPWLKLLPCRDKAGLASLL
DRPSIYKGYYHSQRLRIVSTKVTGIVLEQTLTVVLQPNVKRNNPVSSTEGSLQPNWSMSA
VFKKKITGQCVLAKASRVFLELEEGLVAELEKRVFRDSWSNPLFELSAMPDREIKEINAL
QDQSGSILYEFKVANYNEYEPLDVGMMWKVPLVWSCPHAPFHVSRFLMGSGNERGSLAIS
LQSTQSHEQFLGGSDACTLQVVVFQVVPWYVKVYYHTLQIFIDGKPQTVSDVIEKLQVTP
SEDKLLPGTLELMLRFPCSMHSATLTLDFDKGFLHIDEYPPDANQGFDIPSALVSFPGFQ
SSRSYHEDDSLKNSPLLLKFQEKHVMRSYTEVLLVPLTTPDFSMPYNVITFTCTVLALYF
GSLLNVLRRRIGEEERELKSKAARPGLIPLLLAKLSSKLKGRTDESSQSSPSLSSSSPSI
LGPKLLFKVILIAVLAVFWNYYLNNG
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggagttatcctttactcagggacgatggaactatgagaactggggaggatctgatccg
atgtccagcaccaatgccaagcccccgggtgtcgagctgtggaccctctttgaccttccc
gtcacgcaggttgatgccacttggaaaaatctcacccattccctttcaggtctcttttgc
gcatccatcaactttcttgaatcctccacagcttattctgctcctcgttggggattccat
ccaaattctgacaacctaagatatggtgcattgccccgcgaagcagtttgcactgagaat
ctcactccttggttaaagcttctcccatgtcgagataaagctgggctggcttctctattg
gacaggccttctatttataaaggctactaccattcccaaagattgcggatagtctcaact
aaagttactggtatagttcttgaacagacactgactgttgtgctccaaccaaatgtcaaa
aggaataaccctgtttcttctactgagggatctctgcagcctaattggtccatgagtgca
gtatttaaaaagaagataacaggacagtgtgttcttgccaaagctagtagagtgttcctt
gaactagaggaaggtttagttgctgaacttgagaaaagggtatttagagattcttggagt
aatcctttatttgaattgtctgctatgccagatagggaaatcaaagagatcaacgccttg
caagatcaaagtggttcaattttatatgagttcaaggttgctaactacaacgagtatgaa
cctttggatgtgggcatgatgtggaaggttcctttggtctggtcttgtccccatgcacca
ttccatgtgagccggtttctaatgggaagtggaaatgaacgaggctcacttgctatatca
ttgcaatccacccagtcgcatgagcaattcttaggtggctcagatgcttgtacgctacaa
gtagttgtttttcaggttgttccatggtatgttaaagtttattatcacacactacagatt
ttcatagatgggaagcctcagactgtctctgatgtgattgaaaagttacaagtgacccct
tcagaagacaagttgttacctgggacattggaattgatgcttagatttccttgcagcatg
cactctgctacgttaactttagactttgacaagggattcttgcacattgatgaatatcct
ccagatgctaatcaaggtttcgacattccatcagctttagttagttttcctggcttccag
tcaagcagaagttatcatgaagatgactcactgaaaaattctcccttgcttctgaaattc
caggagaagcatgttatgcggtcttatacagaagtattgcttgtacctttaacaactcca
gattttagcatgccttataatgtcatcacttttacttgcactgttttggcattatatttt
ggatcattgctcaatgtcttgagaagaaggattggtgaggaagagagagaattgaaaagc
aaagctgccaggcctgggttgatccccctgcttctagctaagttgtcttccaagttaaaa
ggacggacagatgagtcatcccagtcatcgccatcattatcatcatcttcaccatctata
ttaggacccaagctattattcaaagtcatattaattgccgtgttagctgttttttggaac
tattatttaaacaatggctga

DBGET integrated database retrieval system