KEGG   Phoenix dactylifera (date palm): 103695725Help
Entry
103695725         CDS       T03274                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00480  Glutathione metabolism
pda00590  Arachidonic acid metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103695725
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103695725
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103695725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 103695725
NCBI-ProteinID: XP_008775339
UniProt: A0A2H3WXV3
Position
Unknown
AA seq 248 aa AA seqDB search
MLCSPPAALSRFVYLRNLSHSASLRLSKPCSSPSQRTLVFAPSRISSSPSRNLRGVGFPF
PVSSSPAASPLFCRFASEMASKSSQATQTVHDFTVKDARGNDVDLSIYKGKVLLIVNVAS
QCGLTNSNYTDLTTLYEKYKDKGLEILAFPCNQFGAQEPGTNEQILEFACTRFKAEYPIF
DKVDVNGDNAAPIYKFLKSSKGSLFGDSIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKD
VKKLLGLN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgttcccctcccgcggctctctctcgcttcgtttacttgagaaatctctcgcac
tccgcctccctccggctctccaaaccctgctcgtctccctctcaaaggaccctcgtcttc
gccccttcgaggatctcttcttctccttcgcggaatctccgtggtgtcggcttccctttc
cctgtttcttcttcaccggcggcgtctcccctgttctgtagattcgcttccgagatggcc
agcaaatcctcccaggctacccaaaccgtccatgacttcactgtgaaggatgccagggga
aatgatgtggacctcagcatttacaagggaaaggttctgctgattgtgaatgtggcatct
caatgtgggttgactaactcgaattacacagacctgactacgctgtatgagaagtacaag
gacaagggtcttgagattctggcttttccatgcaatcagttcggggcacaagaaccagga
accaatgagcagatccttgaatttgcttgcactagattcaaagctgagtacccaatcttt
gacaaggttgatgtaaatggggacaatgctgcacctatctacaagttcctgaaatccagc
aaaggtagtctctttggagatagcattaagtggaatttctcaaagttcttggtcgataag
gaagggcatgtggtggaccgttatgccccgactacttcacctctgagcattgagaaggat
gtcaagaagctgctgggacttaactaa

DBGET integrated database retrieval system