KEGG   Phoenix dactylifera (date palm): 103696031Help
Entry
103696031         CDS       T03274                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00511  Other glycan degradation
pda00600  Sphingolipid metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103696031
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103696031
Enzymes [BR:pda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103696031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Bac_rhamnosid6H EF-hand_5
Motif
Other DBs
NCBI-GeneID: 103696031
NCBI-ProteinID: XP_008775752
UniProt: A0A2H3WYT5
Position
Unknown
AA seq 514 aa AA seqDB search
MDHGSWESQIEDWQRPILQDKRLPEWYKITLFNELYYLNAGGTIWTDGSPPIQSLASIEG
RKFSLDMLNGDFENMTGIISQNNTAVDILDRMASILEKIHAPIASNSAIGTSLLQGDENI
GQFLYLEGIEYYMWNTYDVHFYSSFSLIMLFPRLELSIQRDFAAAVMMHDPEKIQLLHDG
KWASRKVLGAVPHDLGLYDPWFKVNAYTLYNTDRWKDLNPKFVLQVYRDTVATGDKSFAQ
AVWPSVYMAMAYMDQFDKDKDGMIENEGFPDQTYDVWSVTGVSAYSGGLWVAALQAASAM
AREVGDKSSEELFWNKYQKAKSVYEKLWNGSYFNYDNSGGKTSSSIQADQLAGQWYAKAC
GLMPIVDKEKAQSALERVFSFNVLKFKDGKRGAVNGMRPDGTVDMSAMQSREIWPGVTYS
IAAAMIQEGMVETGLRTAQGIYDAAWSQEGLGYSFQTPEAWNNDDQYRSLCYMRPLAIWA
MQWAISPPKLHKEPWTGTSEDALIKHQASFSRVI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggaccatggttcttgggagtcccaaattgaagattggcaaagacctatattgcaagac
aagaggcttccagaatggtacaaaatcactcttttcaatgaactatactatcttaatgct
ggaggaacaatttggacagatgggtcaccgccaatccagagcttggcaagcattgaagga
aggaaattttcccttgatatgttaaatggagattttgagaacatgactgggatcatctca
caaaacaatactgcagtggacatccttgataggatggcatcaatactcgaaaaaatacat
gcacccattgcatcaaattcggctattggaacatcattgcttcagggagatgaaaatatt
ggccagtttctctatcttgaagggatagagtattacatgtggaatacatatgatgtccat
ttctactcctctttttctttgatcatgctatttccaagacttgaactcagcattcaaaga
gactttgctgcagcagtaatgatgcatgaccccgagaagatccaacttctacatgatggc
aagtgggcttcaagaaaggttctaggtgctgtgcctcatgaccttggactatatgaccca
tggttcaaagtgaatgcttacactctttataacacagacaggtggaaagacttgaacccc
aaatttgtgttacaagtttatagagacacagtagctactggtgacaagtcctttgcacaa
gctgtctggccttcagtatacatggcaatggcatacatggatcagtttgataaggataaa
gatgggatgatagaaaatgaaggctttcctgatcaaacttatgatgtttggtcggtgact
ggtgtgagtgcctacagtggcggactttgggtggctgctttacaggctgcatcagccatg
gcacgcgaagttggtgacaaatcctcagaagaacttttctggaacaaatatcaaaaggca
aaatctgtgtatgagaagctgtggaatggttcttacttcaattatgacaatagtggtggc
aagacaagctcatctatccaagcagatcagttggctggacaatggtatgctaaagcatgt
ggtcttatgccaattgttgataaagagaaagcacaaagtgcacttgaaagagttttcagt
ttcaatgttttaaagttcaaggatggaaagagaggagcagttaatgggatgaggccagat
ggcactgttgacatgtctgcaatgcaatcgagagagatatggcctggtgtgacttattcg
attgcagctgctatgatacaagaaggcatggtagaaacaggacttagaactgcacaaggg
atctatgatgctgcttggtctcaggaaggacttgggtattcttttcagacccctgaagct
tggaacaatgatgaccaataccgatccttgtgctacatgcgcccactggccatatgggca
atgcagtgggcaatatcaccaccaaagctccacaaggaaccatggacagggacaagtgaa
gatgctctcataaagcaccaagcatcattctccagagttatttga

DBGET integrated database retrieval system