KEGG   Phoenix dactylifera (date palm): 103696124Help
Entry
103696124         CDS       T03274                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pda00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103696124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pda03041]
    103696124
Enzymes [BR:pda01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103696124
Spliceosome [BR:pda03041]
 Complex C
  Other components
   Step II factors
    103696124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR HA2 OB_NTP_bind zf-C3HC4_2 zf-RING_UBOX DEAD AAA_22 zf-C3HC4 RRM_1 zf-C3HC4_4 Helicase_RecD
Motif
Other DBs
NCBI-GeneID: 103696124
NCBI-ProteinID: XP_017695860
UniProt: A0A2H3ZHH9
Position
Unknown
AA seq 1449 aa AA seqDB search
MILIGETGSGKSTQLVQYLADSGLVTDGSIVCTQPRKIAAISLAQRVAEESYGCYAENYV
VSYPAYSSSQVFNSKVMFMTDHCLLQHCMNGTSLAGISYIIIDEAHERSLNTDLLLALIK
RNLLERYDLRLIIMSATADASKLSDYFCGCSTFYVLGRNFPVEVKYVPDISANASYASIT
KHYSGNYSSYLSDVVKMVNVIHKTEDNGAILAFLTSQIEVEWACEKFDDPSAIVLPMHGK
LSCEEQNRVFQSYPGKRKIVFSTNVAETSLTIQDIKYVVDSGMVKESKFDPSSGMNVLKV
CRISQSSANQRAGRAGRTAPGKCYRLYSEHDFQSMQMHQEPEIRKVHLGIACLRILALGV
KNVQDFEFIDAPSPKAVEIATQSLIQLGAIISYEDAFELTETGHCLIKLGIEPRLGKIIL
DCISCGLIKEGLVLAAVMTNASSIFCRVGSHEQKHKADCLKVPFCHHDGDLFTLLSVYKE
WEDENESKSKWCWQNSINAKSMRRCQDTMQELENCLRHELKIVIPKYWLWNPHKPSKHDK
SLKKVILASLAENTAMYSGCDQLGYKVALTGQNLPLHPSCSLIVYGHKPSWVVFGEILSI
SDQYLFCVTAVDYDCLYKIEPPLFDVLQLESQKMHMNVVTGVGVNLLRRLCGKSNNNLRC
LVSCVQEVCKDKNICIDVDFNKREIQLFAPENNMGKVCSIVNDALELERRWLRDECIEKC
LYHGNLGVSPFALFGSGAEIKHLELQKRYLTVQISHPSAHTLDDKELLMMVDKHGYGIAN
FHKHAGSGQGGSDLNKWGKVTFLSPEAAEDAVARLNDVEFHGSLLKVLPLRAGDHTVLPF
PLVRAKICWPRRPSKGAALIACAKEDAEFIVKDCSALLIGERYVNCEVSVKSKDCVFVTG
IQKDITEPEIYDAFIGATERRILGVRLLRGEAMNNLPPSTYAEFLVREIAPFVPSKNSSN
SFWVEVFDYEPRDWMVKALITFDGNLHLEAANALNYIQGRVLPCCLPWQKIQCQHMFYSS
VSCPPRVYFVLKKQMDQLLQRFKNQKGVSYNLERNENGAFRIKFCANSPKAIADLRNPLE
QLLKGKTVNHPSLTPTVLRSQDGIVLMKTVERETGTCIMYDRQNMIVKVFGPQKVVDAAE
VKLVRAVLSFHENKKLEIRLRGHNLPPGLMKEVVRRFGPDLQGLKEKVPGVEVILKTRYH
ILSVQGSNELKQKVEEIVSEVGQSLGSGSAFEQSPEEAICPICLCELEEPFKLEECGHDF
CRACLIEQCESAIRSRDGFPLCCTKKGCGMPLLLVDLRSLLCRDKLEELFRASLGAFVAS
SEGAYRFCPTPDCPSVYEVSPPNAVAGHFVCGACSAEVCTQCHLEYHPFVSCEQYREFKE
DPNLSVVEWRLGKEHVKDCPSCTHIIEKVDGCNHIACRCGVHICWVCLEPFESSEKCYSH
LASSHHAIV
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgattggggagactggttctggaaagagtacacaattggtccaatatcttgct
gattcagggctagtcactgatggatcaattgtgtgtactcaaccacgtaaaattgctgcc
atatctttagcacaaagggttgcagaggaaagttatggatgctatgctgagaattatgtg
gtttcttatcccgcctactcatcatcccaggtgttcaattctaaggtgatgtttatgaca
gaccattgtcttctgcaacactgtatgaatgggaccagtctggctggtatttcatatatc
atcatagatgaagctcatgaaagaagcttgaatactgatctgttgttggcattgataaag
agaaatctacttgagaggtatgatctaaggcttataataatgtctgctacagctgatgct
agcaaactttcagattacttctgtggttgcagcaccttttatgtactgggaagaaacttc
cctgttgaagtcaaatatgttcctgatatatctgctaatgcttcttatgcttccattaca
aaacattattctggtaattattcttcatatctttctgatgtggttaagatggtgaatgtg
attcacaagacagaggacaacggtgctattcttgcattcttgacttcacagatcgaagta
gaatgggcttgtgaaaagtttgatgacccctctgcaattgttttgccaatgcacggaaaa
ctttcttgtgaagaacaaaatcgtgttttccaaagttaccctggaaaaaggaaaattgta
ttttccactaatgtagcagagacttcacttactattcaagacatcaagtacgttgttgat
tctggaatggtcaaagagagcaagtttgatcctagcagcggtatgaatgtgcttaaggtt
tgcaggatcagccaaagttctgcaaatcaacgagctggtcgagcaggtagaacagcacct
ggcaagtgctacaggctttactcagagcatgatttccaatcaatgcaaatgcatcaggag
cctgaaattcgtaaagttcatcttggaattgcttgcttgaggattcttgcattaggtgta
aagaatgtacaggacttcgagtttattgatgccccaagtccaaaggcagttgagatagca
actcagagtctaatccaattaggtgccataattagttatgaggatgcatttgaattaact
gagactggacactgcttgatcaaattgggtattgaaccacggcttggaaaaattattctt
gattgcattagttgtggcttgatcaaagaaggcttggttcttgctgctgtaatgacaaat
gctagcagcatattttgcagagttggtagtcatgagcagaaacataaagcagactgcctg
aaggtgccattctgccatcatgatggggaccttttcactctgctttctgtttacaaggaa
tgggaagatgaaaatgaaagtaaaagcaaatggtgttggcagaacagcatcaatgctaag
tcaatgagaagatgtcaggatactatgcaggaactggaaaactgccttagacatgaactc
aaaattgtcattccaaagtactggttatggaacccacataaacctagcaagcatgacaag
tcattgaagaaggttatacttgcatcccttgctgaaaatacagcaatgtattctggatgt
gatcaactaggttacaaagtggctttaacaggtcaaaatctgcccctgcatccttcatgt
tcattaatagtatatggccacaagccaagctgggtagtttttggtgaaattttgtcgata
tccgatcaatatttgttttgtgtgactgctgttgactatgattgcttgtacaagattgag
cctccattatttgacgtcttgcagttggagagccagaaaatgcatatgaatgtggttact
ggagttggtgttaatcttcttagaaggctatgtggcaaatccaataataacttacggtgc
ctagtttcatgtgttcaagaagtttgcaaggacaaaaatatctgtattgatgttgacttc
aacaaaagagagattcagttatttgccccagaaaacaatatgggaaaagtttgttctatt
gttaatgatgccttggagttggaaagacgctggttaagggatgaatgcattgagaaatgc
ttgtatcatggaaatcttggtgtttctccttttgcactgtttggttcaggtgctgaaatt
aagcatctagaacttcaaaagagatacctaactgtacagatatcccatccaagtgcacat
actctagatgacaaggaacttctcatgatggttgataaacatggctatggaatagctaat
tttcataagcatgcagggagtggacaagggggatcggacttaaacaaatggggcaaggta
acctttctgagtcctgaggctgcagaagatgctgtagccagactaaatgatgtagaattt
catggttccttattgaaagttcttcctttgagggcaggagatcatactgtgttaccattt
cctttagtaagagccaaaatttgttggccacgtagacctagcaagggagcagcgctgatt
gcatgtgcaaaagaggatgctgaatttatagttaaagactgctctgcattgctcattggt
gaaaggtatgttaattgtgaagtcagtgtaaaatccaaggattgtgtttttgtgacagga
attcaaaaagacattacagaaccagaaatatatgatgcatttataggagcaacagagagg
agaatccttggtgttcgtttgttgagaggagaagccatgaataacctcccaccgtctact
tatgcagaatttcttgttagagaaattgctcctttcgtgccaagcaagaattcaagtaac
agtttctgggtcgaagtctttgactacgaaccaagagattggatggtgaaagctttaatt
acatttgatggcaatctacatttggaagcagcaaatgctttgaattacatccaagggaga
gtgcttccttgctgtctaccatggcaaaagatacagtgccagcatatgttttacagctct
gtatcttgccctcctcgtgtttattttgttcttaagaagcaaatggatcaactacttcaa
aggtttaagaatcagaaaggtgtgtcttataatttggaaaggaatgaaaatggtgccttt
cggataaagttttgtgctaattccccaaaagccattgcagatttgaggaatcctctggag
cagttgttgaaaggcaagacggtaaatcatccaagcctcactccaacagtgctgcgatcc
caggatggtattgtgcttatgaaaactgtggagcgagagactggaacttgcattatgtat
gacagacagaacatgattgttaaagtgtttggaccccagaaagtggtggatgcagctgag
gtgaagctggtgagagcagtactttcgtttcatgaaaacaagaaacttgagatccgactt
cggggccacaacctgcctccaggtttgatgaaagaggttgttcggaggtttggaccagac
cttcaaggattgaaggaaaaggtccctggggtcgaggtgattcttaagacccgatatcat
atcctctcagttcaaggaagcaacgagctgaaacaaaaggtggaagaaattgtatctgag
gtgggtcagtctcttggaagtggcagcgcattcgagcaatcgccggaagaagccatttgc
cccatttgcctctgtgagttggaggagcccttcaagcttgaggagtgtggtcatgatttc
tgtcgtgcctgtttgatagaacagtgcgagtctgccatcagatcacgggatggatttcca
ttgtgctgcaccaagaagggttgtggaatgcctctactgctcgtggacctgaggtctttg
ttatgtagagacaagttggaagaactattcagagcctccttgggtgcctttgtggcatcc
agcgaaggggcctatcgcttctgtcccactcctgactgcccatcggtgtatgaggtctcc
ccaccgaatgcagtggccgggcattttgtatgcggtgcctgctcagcagaggtctgcacg
caatgccatttggagtatcatccttttgtatcctgtgagcaatacagagagttcaaggag
gacccaaacctctcggtggtggaatggcgactgggaaaggagcatgtcaaggactgcccc
tcctgcacccacattatagagaaggtggatgggtgcaaccacatcgcatgccgttgtgga
gtgcacatctgctgggtgtgcttggagccatttgaaagcagtgagaaatgttacagtcac
cttgcttcatcacaccatgctatcgtatga

DBGET integrated database retrieval system