KEGG   Phoenix dactylifera (date palm): 103696240Help
Entry
103696240         CDS       T03274                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase-like
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103696240
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     103696240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 DUF2561
Motif
Other DBs
NCBI-GeneID: 103696240
NCBI-ProteinID: XP_008776011
UniProt: A0A2H3WZF3
Position
Unknown
AA seq 520 aa AA seqDB search
MQLAEMKPLALDLMSAILSGKYDGEGVPPEVRGKWDLVAVLTTSVAVLVGCALLLLWRRS
GGKKAAPAIEPPRPPAVGEEPQHEIDDGRKKVAVFFGTQTGTAEGFAKSLTEEARARYEK
AVFKVVDLDDYAADDDEYEEKIKKETLALFFLATYGDGEPTDNAARFYKWFTEGKERGVW
LQNLQYAVFGLGNRQYEHFNKVAKAVDENLAEQGAKRLVPVGLGDDDQCIEDDFTAWKEL
VWPELDQLLRDEDDAPGASSHYTAAIPEYRVVFLDSTGALHMERNWSLANGHAVHDLQHP
CRANVAVRRELHTPSSDRSCIHLEFDISGTGLAYETGDHXXXXXEIVEEAERLLGYSSDT
FFSIHADKEDGTPLSSSSLAPPFPSPCTLRTALARYADLLNSPKKAALSALAAYASNPSE
AERLRYLASPAGKDEYSQWVVASQRSLLEVMAEFPTAKPPLGVFFAAIAPRLQPRYYSIS
SSPRMVPSRIHVTCALVHGPTPTGRIHKGVCSTWMKVLTI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcagttggcggagatgaagcccttggcgctggatctgatgtcggcgatcctgagcggg
aagtacgacggggagggggtgccgccggaggtgcgggggaagtgggacctggtggcggtg
ctcaccacgtcggtggccgtgctggtcggctgcgcgctcttgctgctctggcggaggtcg
ggcggcaagaaggccgccccggcgatcgagcccccgcggccgccggcggtcggggaggag
ccgcagcacgagattgatgacgggagaaagaaggtcgccgtcttctttggcacccagacc
ggcaccgcggaaggcttcgccaagtctctgaccgaggaggcaagggcgcgatatgagaag
gccgtcttcaaagtggttgatcttgatgattacgcagctgatgatgatgaatacgaggag
aagatcaagaaagagacgttggcgttgttcttcttggcaacttatggagatggtgaacca
acggataatgctgctaggttctacaaatggtttaccgaggggaaggagaggggagtttgg
cttcagaatcttcagtatgcagtgtttggtctggggaacagacagtatgaacattttaat
aaggtcgccaaagcagtggatgagaatcttgctgaacaaggtgcgaagcgcctagttcca
gtgggccttggagatgatgatcaatgcattgaggatgactttactgcatggaaggagctg
gtgtggccagagttggatcaactgcttcgagatgaagatgatgcaccaggggcatctagc
cattacactgctgccataccagaataccgggttgtgtttcttgacagcacaggtgcatta
catatggagaggaactggagtcttgccaacggccatgctgttcatgaccttcaacatcct
tgcagagctaatgtggctgtgcggcgggagctacatacaccatcttcggatcgttcctgc
attcatcttgagtttgacatttctggaactggacttgcgtatgaaactggagaccacnnn
nnnnnnnnnnnngagattgtggaggaggctgaaaggctcttaggctattcatcagataca
ttcttctccatacatgcagacaaagaggatggcacaccattaagtagcagctctctagcg
cctcctttcccatctccatgcactttgagaacagcacttgctcgatatgcagaccttcta
aattcaccaaaaaaggctgctttatctgctctagctgcttatgcttctaatccaagcgaa
gctgaacgattaagatatctagcttctcctgcaggaaaggatgaatattctcaatgggta
gttgcaagtcagaggagccttcttgaagttatggcagaatttcctacagctaagcctcct
ctaggtgttttctttgcagctatagctcctcgcttgcaacctcgatattactctatatca
tcttctccaaggatggtaccttctagaattcatgtcacatgtgcgttagtgcatggacca
acaccaacaggaaggattcacaaaggagtttgttcaacctggatgaaggtattgactatt
taa

DBGET integrated database retrieval system