KEGG   Phoenix dactylifera (date palm): 103696471Help
Entry
103696471         CDS       T03274                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: separase
  KO
K02365  separase [EC:3.4.22.49]
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pda01002]
    103696471
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pda03036]
    103696471
Enzymes [BR:pda01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     103696471
Peptidases and inhibitors [BR:pda01002]
 Cysteine peptidases
  Family C50: separase family
   103696471
Chromosome and associated proteins [BR:pda03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    103696471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 TPR_10 TPR_2 CHAT
Motif
Other DBs
NCBI-GeneID: 103696471
NCBI-ProteinID: XP_026656708
UniProt: A0A3Q0HPS7
Position
Unknown
AA seq 2271 aa AA seqDB search
MDSTTASSLLGALRSSDCRGLYDRFSSFLLPFGNFIPLDSHRPGAGKSTGAASKKRGAPK
KKKPEIDSQLLRPLAKQFLPFLCHALKLLPALLRKIPKPPSDGGGGGGREEDEQRATELL
GVYGLTIDCLSCIGPCLAGKPYSVHLQWGRLVCSLEAWGRYARAEKEAISLLESLRSVLV
AAAPERKSQRGKDADPISLLPDPKLVCADDPEVATMAIEVIICLVGCAFKSKSRDGAAYE
RILALVDQVQPWLQFLDPEAIKKYHLLLVNALYRCSQFLAGESMSFDGYLAKAFCLRTLR
ECLKSSSMDRFPMIARKICSSIDSEWEGRAPLLLDMLRETLESGVCGCKVGVVKAVNHVL
EFVSYCADIICAANVNVCKSALKVLYEQGDDFLQVSPPFASILILYASGLYIKSSNIQAR
QYADIFHSSNDGSSIILLLDNGENVQKLTDSLGNLARYFDMKKRDSRDLSTVVPESTKHG
ACKHLHGSVSFISYLDALEFLCKLLYEYVNIAAKHLVSERKTVLRLANANHVLDALHQFC
DFILSALECTKTFESYRERLHDSYGTLLQVAASAFKFSLLTFGNYQKSLCSINCIISSEW
IEPQELKFLIAVLSNIGASLYDMGHFEEAAIALQLCCRTMWTHVKLLCHLGKSNGTDIDE
NSEDGMRDVINNAFTRTATIVDILHKCSAKNFQEVVVESLYEFSAAEDRFQSMAFSLDLV
KMWVKIVCKDFEDVDSVDMAPVLYSLLMSYYPMWSKKTVGFSKKKKTVGKILEQELIAYG
MMEARYPKICQKMQLKVINILLNEVYTTKDYYIQRSRIFVRKGKVIRGCGVEGLSRCIEC
LSEAISLLKDISGNPSQRNASVLHQLALYCLLAQCAQEANQDGKIILDNVQYAIKLWSSI
DIQSCSADSHLERASENVIPILCSVIDLLSLKGCLKFQNDIRQLMITLCKWENIPLEKCI
AMLWSGRRLNHSLCSSPISEDFILDMSKNPGVNADSFDYWINCTKSHPPSLCMFQQNLSL
TNSVFPEVSGCTERSFGSQITVDEVKKVASSLTVDVPLPAQSAFIAGYLYYDLSERLFSS
GRISEALSYAREAFRLRKKLLQRKFIYSVEKQSAKSIGSARVTQSGHDHICLEAMGSVIT
EVWPDIFKSGNSGDFILTPWSILGCYLESILQVGIIHESMGNGTEAENLFQRGKGISSLQ
GLPILEIAFTSLLGQLYRRKQLWDLAETEFNNARTLLAKNDMIISCKHCKLAFEVTIDMQ
IGDLFRNLFDKGLKIESTKSLSDALDLYRSALKKLNRAESCSYPTEDAKHGDVNADKVRF
LAKKVRSPVCSIRASLNHISGIPHAGQMPSEDDRLSLLNAVGKKSLLNMKLRKRCKNSSK
FIAKEQNLNAELKPRRTRSTNRDANMETEVESKYDRSDSCEFCPDTESLGKVEKKQDETS
SSDFGCSEQCICNKLTCSRCLVTNVMQTGSMKNIIHLKRECHRRRFVLVLLLKIARCLGA
HDGKHAEHEVHDALLQYISVLFSIKPFCQSCHGIPDCRLIELVVDENSGYAFSIERAALL
YNMSWLLLKDCLTEHPRTMCCSLSKMQMSNIVSWLLRAFILCRQLPLLSQKVSRLLSSIF
LLSTLDGSITLPLHSEKSLSLNHWAAYFHQASIGTYMHCQYLSCVRDVACNNNKTSEGLP
SANIMDADTKASMFFRSVPEKLEHIEQHVKGFFQSLPRVPIICISMLGGDYVNLLGESSV
LPSSCPAWMLLSRLDAFSEPVVMLLPVDILEDIQLEDTNSDKRLICTNMGSGRDWQCPWN
YTIVDHVAPSFKLLLEENFLSVSSTTLTPANAQMSNVGWWLLRTRLNSCLNKLLKSMEES
WLGPWRCLLLGQHSDPEYLDITVSKLIRDLKSQFKFEVNVSLIRAILGGAKSVDDAEACI
SQLLLYKGYFGRGACCGEERFGALSAACHSGIESVSELVHSLIQEATKKQEERIHRDPII
LVLDSDLQMLPWENLPILRSQEVYRMLSVGSILSVLNRCCSVHKLDKDFSAVLPAVDPFN
TYYLLNPSGDLDSTQAEFEQWFRDQKWEGIAGNVPTTEELVLALQNHELFLYFGHGSGTQ
YISVHEIQKLDRCAASLLMGCSSGSLVHNGCYAPQGVPISYLFAGSPAVIANLWDVTDKD
IDRFGRAILDSWLQEESAALDNCTRCDQLVRHFGCMGIDGEGNDTILKTRKRTYRGKKLQ
QSSESNKCKGYGRRKMIASFMSQARDACKLPLLIGASPVCYGVPTIISRKS
NT seq 6816 nt NT seq  +upstreamnt  +downstreamnt
atggactccaccaccgcctcctccctcctcggtgccctccggagctccgattgcaggggc
ctgtacgatcggttctcctccttcttgctcccattcgggaatttcatacctctcgactcc
caccgccccggcgctgggaagagcaccggtgctgcctctaagaaacggggcgctcctaag
aagaagaagcccgagattgactcccaactgctccgcccccttgcgaagcagttcctcccc
ttcctctgccatgctcttaagctcctgcccgcccttctccgcaagatccccaaaccgcct
tccgatggcgggggcggtggaggacgagaggaggatgaacagcgggccaccgagcttctc
ggagtttatgggctcaccatcgattgcttgtcgtgcatcggtccctgcctcgccggaaag
ccctactccgttcaccttcagtggggccggctggtctgcagcttggaagcatggggaagg
tacgcaagggctgaaaaggaggccatctctctcctcgagagcctccgctctgttcttgtt
gcagccgcaccggaacgcaagtcacagaggggaaaggatgccgatcctattagcttgtta
cctgatccaaagcttgtctgcgctgatgatcctgaagttgccacgatggccattgaggta
attatctgcctcgtgggctgtgccttcaagagcaagtcaagggacggggctgcctacgag
aggattctggctctggttgaccaggtccaaccatggcttcagttcctagatcctgaggca
ataaaaaagtaccatttgttgcttgtaaatgccctctacaggtgttcgcagttcctggct
ggggagtccatgtcgtttgatggttatctagcgaaggctttttgtctgaggacattgagg
gagtgtttgaagtcgtcttcaatggatcgcttcccaatgattgctcgcaaaatctgctct
tcaattgactcagagtgggagggtagagccccgcttctgcttgatatgctaagagaaact
ctggagtctggtgtatgtggatgcaaggttggtgtcgtgaaagctgtaaatcatgttctt
gagtttgtatcatattgcgctgacataatttgtgctgccaatgtaaatgtctgtaaaagt
gctctgaaagtattatatgaacaaggagatgatttccttcaggtttcacctccttttgcc
tcgattctgattctttatgccagtggattgtatattaagtctagcaatattcaggctagg
caatatgctgatatttttcacagttcaaatgatggctcttcaattatattattgcttgat
aatggagagaatgtgcaaaaattgactgattctctgggtaacttagcaagatactttgac
atgaagaaaagggattcaagggatttgtcaactgtagttccagagtctaccaagcatgga
gcttgtaaacacttgcatggaagtgtttcctttatatcatacttagacgctttggagttt
ttatgcaagctattatatgaatatgtaaatattgctgcaaagcacttggtttctgaaagg
aaaactgttctcagattggctaatgcgaatcatgtcctggatgctttacatcagttctgt
gatttcattctttctgcacttgaatgcaccaaaacatttgaaagctatagagaaaggtta
catgatagctatggaacattgcttcaagtagcagcttcagctttcaaattttcccttctg
acttttggaaactaccagaagagtctgtgctctattaattgtatcatttcaagtgaatgg
atcgagcctcaagagctgaagtttctgattgcagtgctcagtaatattggtgcctcactg
tatgacatggggcactttgaagaggcagcaatagcattgcagttatgttgtagaacaatg
tggacacatgtcaagctcctttgtcacttaggcaaatcgaatggcactgacattgatgaa
aattctgaggatggaatgagagatgttatcaataatgcattcacaaggactgctacaata
gtagatattcttcacaaatgcagtgccaaaaattttcaggaagttgttgtcgagagtctg
tatgaattttctgcggcagaagataggtttcagagtatggctttctctttggacttggtg
aagatgtgggttaagatagtatgcaaagattttgaagatgtcgattcagtggatatggct
cctgttctctattccttgctaatgagctattatccgatgtggtcaaagaagacagtgggt
tttagcaaaaaaaagaagacagtgggaaagattcttgagcaggagcttatagcatatgga
atgatggaagctagatatccaaagatatgccagaaaatgcaactaaaagttataaatatt
ctcttaaatgaagtatatactacaaaagattattatattcagagatcaaggatttttgtt
agaaagggaaaagtaattagaggttgtggagtagaagggctcagccgctgtattgagtgc
ctctctgaagctatttccttgcttaaggacatctcaggtaatccttctcagcgcaatgct
tcagttttgcatcagttggctctatactgcttgcttgcacagtgtgctcaggaagctaac
caagatggcaagataatcctggacaatgtccaatatgcaataaagttatggtcgagcata
gacatccaaagttgttctgcagatagccatcttgaaagggcatcagaaaatgtgatacca
atattgtgttctgtaattgatttgttgtctttgaagggttgcttgaaatttcagaatgac
atccgtcaactgatgatcacgttatgcaagtgggaaaacatcccattggaaaaatgcatt
gctatgctatggagtggaagaaggcttaatcattcactctgcagttctccaatatctgag
gattttattttggatatgtcaaaaaaccctggtgttaatgcggactcctttgattattgg
ataaactgtacaaaaagtcatccaccatctctatgcatgtttcaacagaatttgtcactt
actaattctgtttttcctgaagtaagtggatgtactgaaagatcctttggttcacaaatt
actgtggatgaagttaaaaaggttgcatcatctctaactgtggatgttcccttgcccgct
caatcagcttttattgctggatatctttactatgatttgtctgaaagacttttctccagt
ggacgaatttccgaggctctttcatatgcgagagaggccttccgcttgcgcaaaaagctt
ttgcagagaaaattcatatattctgttgagaagcagtctgcaaaatcaattggttcagca
cgagtaactcaatctgggcatgaccatatttgccttgaggcaatgggatcagttattact
gaagtttggccagatattttcaaatcaggcaactcaggagattttattctgacaccatgg
agcattcttggatgctaccttgagagcattttgcaggttggaataatccatgaatcaatg
ggtaatgggacagaagccgaaaatcttttccagaggggaaaagggatatcctctttgcaa
ggtttacccattcttgagattgcttttacatcattactaggtcaattataccgtaggaaa
caactctgggatttagcagaaacagagttcaataatgccaggacacttcttgcaaaaaat
gacatgattatttcctgcaagcactgcaagttagcctttgaagttacaattgatatgcag
attggagatttatttagaaacctctttgataaaggtttgaagatagaatcaacaaagagc
ttatcagatgctcttgacttgtatagatcggctctaaagaaactgaatcgtgctgaatca
tgcagttatcctacagaagatgcaaagcatggagatgtgaatgctgataaagtgcggttt
ctggcgaagaaagtgagatcacctgtctgcagtatccgtgcttcattaaatcacatttct
ggcatccctcatgctggacagatgccatcagaggatgacagactgtctcttctgaatgct
gtaggtaaaaagtcacttttaaacatgaaactgaggaaaagatgtaaaaattcatcaaaa
tttattgcaaaggaacaaaatttgaatgctgaacttaaaccaagaagaactcgttctact
aaccgagatgcaaatatggaaactgaagtggaaagcaagtatgacagatctgacagttgt
gagttttgtcctgataccgagagtcttggcaaagttgaaaagaaacaggatgaaacttct
tcatctgactttgggtgcagtgaacaatgcatatgcaacaaattaacttgttcgagatgc
cttgtaaccaacgtgatgcaaactggatccatgaaaaatattatccatctgaagagggaa
tgtcaccgtaggcgttttgtattggtgctgctcttaaagatagcaagatgtttaggggct
catgatgggaaacatgcagaacatgaagtacatgatgcattattgcaatatatatctgta
ttgttcagtataaaaccattctgtcagagttgtcatggaattcctgactgccgcttgatt
gagcttgttgtcgatgagaattcaggttatgctttttctattgaacgtgcagcactttta
tacaacatgagctggcttttactaaaggactgcctcacagagcatcccaggaccatgtgt
tgcagtctttccaaaatgcagatgtcgaatattgtttcatggttgttgagagccttcata
ctctgtcgtcagctccccttactttctcaaaaggtctccaggctcctttcttctatattc
ttactttccacattagatggctccattacattacctttgcattctgaaaaatctctctct
ctaaatcattgggctgcatattttcatcaagcttccattggtacttatatgcattgtcaa
tacctttcttgtgttagagatgtggcctgcaacaacaataagacttcagagggtctccct
tctgctaacattatggatgcagataccaaggcttccatgttcttcagatctgtgccagaa
aaacttgaacatattgaacaacatgtgaagggcttcttccagagcctccccagggttcca
attatctgtataagcatgcttggaggtgattatgtgaacctccttggagaatcatctgtt
ctaccatctagttgccctgcatggatgttgctatcaagattggatgcatttagtgaacca
gttgtcatgcttcttcctgtagacattctggaagatattcaacttgaagatactaactct
gacaaaagattaatctgcacaaacatgggatcaggcagggattggcagtgcccttggaat
tacactattgtagatcatgttgctccatcttttaaacttcttttggaagaaaacttctta
tcagtatctagcacaacccttacaccagctaatgcacaaatgagcaatgttgggtggtgg
ttgctgaggacaaggctcaacagttgcctcaataagttgctgaaaagcatggaagaatca
tggttgggaccctggaggtgcttgcttttgggtcagcattctgaccctgaatatttggat
ataacagtttccaaattaatcagagatctgaaatcacagttcaagtttgaagtaaatgtt
agcctcattagagcaatccttggtggtgcaaagtctgtagatgatgcagaagcatgtatt
tctcagctgctactttacaaaggctactttggcaggggagcttgttgtggggaggaaaga
tttggggccctttcggctgcatgccattctggaattgaaagtgtgtctgagttggttcac
agtttaatacaggaagcaactaaaaaacaagaagaacgaattcacagagatccaataatt
ttagttctggattctgatttgcagatgctcccttgggaaaatctaccaatattaaggagt
caggaggtttatcgcatgctttctgttgggtctatcctttcagtgcttaacagatgctgt
tccgttcacaagttggataaggactttagtgctgtccttccagctgttgaccctttcaac
acttactacttgttgaaccctagtggagatcttgacagcacgcaggcggaatttgaacag
tggttcagagaccagaagtgggagggaatagctggaaatgttccaacaactgaagaatta
gttttggcattgcaaaatcatgagctgtttctatactttggccatggaagtggaacacaa
tatatctcagtacatgaaattcagaaattggatcgttgtgcagcctctcttcttatgggc
tgtagtagtggatccctcgtgcacaatgggtgttatgctcctcaaggagtccctatttcc
tatttgtttgctggttctcctgctgtcattgcaaatctttgggatgtaacggataaggat
attgaccggtttggcagggccattcttgattcatggctgcaagaagaatctgctgccctc
gacaattgtactaggtgcgaccaattagttagacattttggatgcatgggcatagatggt
gagggaaatgataccattttaaagactagaaaaagaacatacagaggaaagaagttgcaa
caatcgagtgaaagcaataaatgcaagggttatggaagaagaaagatgatagcatcattc
atgagccaagcacgagatgcttgcaaactccccctacttattggagcatctcctgtttgt
tatggtgtacctacaattataagtaggaaatcataa

DBGET integrated database retrieval system