KEGG   Phoenix dactylifera (date palm): 103696667Help
Entry
103696667         CDS       T03274                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 6
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00520  Amino sugar and nucleotide sugar metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103696667
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     103696667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind KR
Motif
Other DBs
NCBI-GeneID: 103696667
NCBI-ProteinID: XP_008776577
UniProt: A0A2H3X0Q5
Position
Unknown
AA seq 342 aa AA seqDB search
MAKESSNGVSKPPPMPSPLRNSKFFQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVAD
NFFTGSKDNLRKWIGHPRFELIRHDVTEPLLVEVDQIYHLACPASPIFYKYNPVKTIKTN
VIGTLNMLGLAKRVGARILLTSTSEVYGDPLEHPQKEEYWGNVNPIGVRSCYDEGKRVAE
TLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGESLTVQAPGTQTRSF
CYVSDMVDGLIRLMEGDNTGPINLGNPGEFTMMELAETIKELIDPTVPVKVVENTPDDPR
QRKPDITKAKELLGWEHKVTLRQGLPLMEEDFRRRLGVPKKA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaatcttccaacggggtgtcaaagccgcctccgatgccttccccactgcgg
aattccaaattttttcagtccaatatgagaatcttggtgacggggggcgctggattcatt
gggtctcatttggtggacaagttgatggagaatgaaaagaacgaggtaattgttgctgac
aactttttcactggttcaaaggacaatcttagaaaatggattggtcatccaagatttgag
ctaattcgacatgatgtcacagagccattgctggtagaggtggatcaaatctatcatctt
gcttgccctgcctctccaattttctacaaatacaaccctgtgaagacgataaagacaaat
gtcattggcacactaaacatgttgggacttgcaaagcgggttggagcaaggattttgctg
acctcaacctcagaggtttatggtgatcctcttgagcatcctcagaaggaggagtactgg
ggaaatgttaacccaatcggagtcaggagttgctatgatgagggcaagcgtgtggcagag
actttaatgtttgactatcataggcagcatggcatagagattcgtattgctagaattttt
aacacatatggaccacgcatgaacatcgatgatggtcgtgttgtcagtaactttatagct
caggcgcttcggggcgagtccttaactgttcaagcacctggaacgcaaactcgaagtttc
tgttatgtttctgatatggttgatggacttattaggctgatggaaggagataacacaggc
cctatcaatttaggaaaccctggagaatttacaatgatggaacttgctgaaaccattaag
gagttaattgatcccacggtgcctgtgaaagtagtggagaatacacctgatgatcctcgc
caaaggaagccagacatcacaaaagccaaggagttactaggatgggagcacaaggttaca
ctacggcagggccttcctctcatggaagaggacttccgacggcgtcttggcgtgcccaaa
aaagcataa

DBGET integrated database retrieval system