KEGG   Phoenix dactylifera (date palm): 103696760Help
Entry
103696760         CDS       T03274                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda03040  Spliceosome
pda04141  Protein processing in endoplasmic reticulum
pda04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pda00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103696760
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103696760
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103696760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pda01009]
    103696760
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pda03041]
    103696760
   03009 Ribosome biogenesis [BR:pda03009]
    103696760
   03110 Chaperones and folding catalysts [BR:pda03110]
    103696760
   04131 Membrane trafficking [BR:pda04131]
    103696760
   03051 Proteasome [BR:pda03051]
    103696760
   03029 Mitochondrial biogenesis [BR:pda03029]
    103696760
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pda04147]
    103696760
Protein phosphatases and associated proteins [BR:pda01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103696760
Spliceosome [BR:pda03041]
 Complex B
  Other components
   Prp19 complex
    103696760
 Complex C
   Prp19-CDC5 complex
    103696760
Ribosome biogenesis [BR:pda03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103696760
Chaperones and folding catalysts [BR:pda03110]
 Heat shock proteins
  HSP70 / DNAK
   103696760
Membrane trafficking [BR:pda04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103696760
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103696760
Proteasome [BR:pda03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103696760
Mitochondrial biogenesis [BR:pda03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103696760
Exosome [BR:pda04147]
 Exosomal proteins
  Proteins found in most exosomes
   103696760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C AAA_15 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103696760
NCBI-ProteinID: XP_008776699
UniProt: A0A2H3X110
Position
Unknown
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAINPINTVFDAKRLIGRRFSDASVQNDMKLWPFKVVAGPGDKPLIAVQYKGEEKQFAA
EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLSVMRIVNEP
TAAAIAYGLDRKAGSAGEKNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
SRMVSHFVQEFKRKHKKDISGNPRALRRLRTACERAKRNLSSTAQTTIEIDSLFEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHEVVLVGGSTRIPRVQQMLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLVQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKDTRQKNKITITNDKGRLSKEEIEKMVREAEKYKAEDEKHKK
KVEAKNALENYAYNMRNTIRDDKIASKLAAADKKKIEDAIEQAINWPDSNQRAEADEFED
KLKELEGICNPIIANMYQGAGADMAGGMAEDGPAAGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaagggtgaaggtccggcgatcgggatcgatctcgggacgacctactcgtgc
gtcggcgtgtggcagcacgatcgggtggagatcatcgccaacgaccaggggaaccggact
actccctcctacgtcgccttcaccgatagcgagcggctcatcggcgatgccgccaagaac
caggttgccataaaccccatcaacaccgtcttcgatgcaaagcgtttgattggcagacgg
ttcagtgatgcttccgtgcagaatgacatgaagctatggccctttaaggtggttgctggt
cctggagataagcctttgatagctgtccaatataagggggaggagaaacaatttgctgca
gaagaaatatcctctatggtgttgataaaaatgcgcgaaattgcagaggcttaccttggt
tctacagttaagaatgctgttgttactgtccctgcttacttcaatgactcacaacggcaa
gctacaaaggatgctggtgtcattgcaggcctcagtgtcatgcgtatcgttaatgagcct
acagctgctgccattgcctatggtcttgacaggaaggctggcagtgctggggagaagaat
attctcatttttgaccttggtggtggcacttttgatgtctccctcctcaccatcgaagag
ggaatttttgaggtgaaggccactgctggtgacacccatttgggtggtgaagactttgac
agccgtatggtgagccactttgttcaggagttcaagaggaagcacaagaaggatatcagt
ggcaatcctagggctcttaggaggctgaggacagcttgtgaaagggcaaagagaaattta
tcatctactgcccaaacaacaatcgagattgattccctatttgaaggcattgatttctac
tcaaccatcacccgtgcaaggttcgaggaactcaacatggatcttttcagaaagtgcatg
gagcctgttgaaaagtgcctgagagatgctaagatggacaagagttcagtccatgaagtt
gttcttgttggtggatcgaccaggatacccagagtccagcaaatgctgcaggatttcttt
aatgggaaggaactctgcaagagtatcaaccctgatgaagctgttgcatatggtgctgct
gttcaagccgccatcttgagtggtgagggcaatgaaaaagtgcaggaccttctgttgctg
gatgtcactcctctttcccttggattggagactgctggaggagtcatgacagtgttgatt
ccaaggaacaccaccatccccaccaagaaggagcaagtcttttccacctactctgacaat
caacctggtgtcttggtccaggtctacgagggggagaggacaaggacaaaggacaacaac
ctgctagggaaatttgagctttctgggatcccgcctgctccgaggggcgtacctcaaatc
actgtctgcttcgatatcgatgccaacggtattttgaatgtctcagcagaggataaggac
accaggcagaagaacaagataactattactaatgataagggtaggctgagcaaggaggaa
attgagaagatggttcgagaggctgaaaaatacaaagctgaggatgagaagcacaagaag
aaggtggaggccaagaatgcactggagaattatgcatacaacatgagaaacaccattagg
gatgataagattgcgtccaaactggctgcagctgacaagaagaagattgaggatgcaatc
gagcaggccatcaattggccggacagcaaccagcgagctgaggctgatgaatttgaggac
aagttgaaggagctggagggcatctgcaatccgattatcgccaatatgtaccagggtgca
ggtgctgatatggctggtggcatggccgaagatggtcctgctgctggtggaagtggtgca
ggtcccaagattgaggaggtcgattag

DBGET integrated database retrieval system