KEGG   Phoenix dactylifera (date palm): 103699154Help
Entry
103699154         CDS       T03274                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00511  Other glycan degradation
pda00600  Sphingolipid metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103699154
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103699154
Enzymes [BR:pda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103699154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 103699154
NCBI-ProteinID: XP_008779428
UniProt: A0A2H3X7G3
Position
Unknown
AA seq 244 aa AA seqDB search
LLLEKSLALSLLLEILTFSAGSIGRSYKGDFQRWQLFPGICEDKPVLANQFSVFISRSDG
KKYSAVLSPGNPEALKGNNISGAGSWDWNLNGQKSTYHALYPRAWTVFDGEPDPDLKIIC
RQISPFIPHNYQESSYPVAVFTFTLINLGKTAAKVTLLFSWANSVGGNSEFSGYHFNSKM
IEKDGVHGVLLHHRTADGKPPVTFAIAAQQTADVHVSECPYFLISGSSDAFTARDMWHAI
KEVE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgcttctggaaaaatctcttgccctctccttattgttggaaattttgacctttagtgca
ggaagtattggaaggagctacaagggtgattttcaacgttggcagctgttccctggaata
tgtgaagataaacctgtattagcaaatcaattttctgtatttatttcacggtcagatggt
aaaaaatattctgctgtgctgtcccctgggaacccagaagcgctcaaaggaaataacatt
tcaggagctggatcttgggactggaacctgaatggacagaagtctacctatcatgctctt
tatccaagggcctggactgtatttgatggggaacctgatccggatctcaaaataatatgt
cgtcagatttcaccatttattccccacaattaccaggaaagcagctatcctgttgcagta
tttactttcacgctaatcaatttggggaagactgctgcaaaagtaaccttgctattttca
tgggctaattctgtgggtggcaactctgagttttctggatatcatttcaattccaaaatg
atagaaaaagatggtgtgcatggagtacttttacatcatagaactgcagatgggaaacct
ccagtaacatttgcaatagcagcacaacagacagctgatgttcatgtctctgaatgtcca
tactttttgatatctggaagcagtgatgcatttacagcaagagacatgtggcatgcaatt
aaggaggttgaatga

DBGET integrated database retrieval system