KEGG   Phoenix dactylifera (date palm): 103701342Help
Entry
103701342         CDS       T03274                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member H1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00010  Glycolysis / Gluconeogenesis
pda00053  Ascorbate and aldarate metabolism
pda00071  Fatty acid degradation
pda00280  Valine, leucine and isoleucine degradation
pda00310  Lysine degradation
pda00330  Arginine and proline metabolism
pda00340  Histidine metabolism
pda00380  Tryptophan metabolism
pda00410  beta-Alanine metabolism
pda00561  Glycerolipid metabolism
pda00620  Pyruvate metabolism
pda00903  Limonene and pinene degradation
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103701342
   00053 Ascorbate and aldarate metabolism
    103701342
   00620 Pyruvate metabolism
    103701342
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103701342
   00561 Glycerolipid metabolism
    103701342
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103701342
   00310 Lysine degradation
    103701342
   00330 Arginine and proline metabolism
    103701342
   00340 Histidine metabolism
    103701342
   00380 Tryptophan metabolism
    103701342
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103701342
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103701342
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103701342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103701342
NCBI-ProteinID: XP_008781593
UniProt: A0A2H3XC23
Position
Unknown
AA seq 495 aa AA seqDB search
MDSGKKPAAMGGGGFDGERAAEMVAELRETFRSGRTRSLEWRAAQLKALVRMIEEKESDI
MGALYADLAKPQLESYLHEISLVKSACSFALKQLKRWMKPEKVPASITTFPSTAEIVSEP
LGVVLIISAWNYPVLLSIDPVIGAIAAGNAVVLKPSDLAPATSSLFARILPDYIDNSCIR
VVEGSIPEATALLEQKWDKIFYTGNGNVGRIVMTAAAKHLTPVVLELGGKSPVVVDSNID
VKVAARRIAVGKWGCNNGQACIAPDYIITTKSFAPILVDSLRRTLEKFYGEDASESKDLS
RIVNANHFKRLTSLLDDEKVSGKIVHGGQRDEKHLYIAPTLLLDVPHDSLIMKEEIFGPL
LPIITVDKVEDSFDVINSKSKPLAAYLFTKDKKLEEKFVKIVSAGGMLINDTVLHLANPY
LPFGGVGESGFGSYHGKFSFEAFSHKKAVLSRGFGGETSARYPPYTPQKQKLLRQLLNGS
IIALFLALIGWPRGG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggatagcggaaagaagccggcggcgatgggcggaggaggattcgatggcgagagggcg
gcggagatggtggcggagctgagggagaccttcaggtcggggaggacgaggagcctcgag
tggagggcggcgcagttgaaggctctcgtgaggatgatcgaggagaaggagtccgacatc
atgggcgccctctatgctgacctcgccaagccacagctcgagtcttaccttcacgagatt
tcgctggtaaagtctgcatgttcatttgctctcaaacaattgaaacgttggatgaaacca
gaaaaggtgccagcttctattacaacttttccatcaacagcagaaattgtgtcagagcct
ctaggtgttgtgctgatcatttcagcatggaactatcccgttttgttatctattgaccca
gtcatcggagccattgcggctggtaatgctgttgttttaaagccatcagatcttgcgcca
gccacatcatcattatttgcaagaatattaccagattacatagataactcttgtataaga
gttgttgagggctctatccctgaggcgactgcgcttttggaacaaaagtgggataaaata
ttttatacaggtaatggaaatgtaggccgcattgtgatgactgcagctgcaaagcatcta
acaccagtagttttggagctcggaggaaaatctcctgttgttgttgattcaaatattgat
gtaaaggttgcagcgaggcgaattgctgtgggcaagtggggatgcaacaatggacaagct
tgcattgctccagattacattataacaactaaatcatttgctccaatattggtggactcc
ttaagaagaactttggagaaattttatggggaggatgcatcagaatctaaagatttatct
cgcattgtgaatgctaatcattttaaacgcttgactagtctcttggatgatgaaaaggtt
tctggcaagatagtccacggaggccagcgggatgagaagcacctatatatagctcctaca
ctcttattagacgttccacatgattcattaataatgaaggaggaaatatttggtccatta
cttccaattatcacagttgacaaggtggaagatagttttgatgttataaactcaaagtcg
aagcctcttgctgcctatctcttcaccaaggacaagaagctggaagagaagtttgtgaaa
attgtatctgctggggggatgctcataaatgacacagtgttacatcttgcaaacccttac
ttgccgtttggtggggtcggggagagcggattcgggtcataccatggcaaattctcgttt
gaagcatttagtcacaagaaagcagtgctgtcccgtggttttggtggggaaacatctgca
agataccctccatatacaccccaaaagcaaaaacttctgaggcaactcctcaatggcagt
atcatagccctgttcctcgctctgattggatggcctagaggtggttga

DBGET integrated database retrieval system