KEGG   Phoenix dactylifera (date palm): 103701555Help
Entry
103701555         CDS       T03274                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2-like isoform X1
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pda01009]
    103701555
Enzymes [BR:pda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     103701555
Protein phosphatases and associated proteins [BR:pda01009]
 HAD phosphatases
  Other HAD phosphatases
   103701555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 103701555
NCBI-ProteinID: XP_008781896
UniProt: A0A2H3XD26
Position
Unknown
AA seq 244 aa AA seqDB search
MAAAPSSEEKASPTKGPITHVIFDMDGLLLDTEPFYTVVQERILARFGKTFDWSLKAKMM
GKKAIESAHIFVEESGLNGLLTPEGFLEEREGMLQELFPTCQLMPGVKHLVNHLHANGIP
MCVATGSYKRHFELKTQNHGEIFAMMHHVVMGDDSAVKKGKPSPDIFLAAANRFEENVDP
STILVFEDAPLGVVAAKNAGMSVVMVPDPRLDVSYHKEADQALSSLLDFKPSEWGLPPFE
DVVN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgccctcctcggaagagaaggcctctccaaccaaaggccccatcacccac
gttatcttcgacatggatggcctcctcctcgacacggagccgttctacacggtggtgcag
gagcggatcctggcgaggttcgggaagacgttcgactggtcgctcaaggcgaagatgatg
gggaagaaggccatcgagtcggcccatatcttcgtggaggagtccggcctcaacggcctc
ctcacccccgagggattcctcgaagagagggagggaatgctgcaggagctcttccccact
tgtcagctcatgcccggagtaaaacatttggtgaatcatcttcatgcaaatggtataccg
atgtgtgtggcaacagggtcctataaacgacactttgaactgaaaacacaaaatcatggt
gaaatttttgctatgatgcatcatgttgtcatgggtgatgattcagcagtaaagaaaggc
aagccatctccggatatatttcttgctgctgcaaacagatttgaggaaaatgtggaccca
agtacaattttagtttttgaagatgcaccattaggagtagttgcagctaagaatgcaggg
atgtccgtggttatggtcccagatccaaggctggacgtttcttatcacaaagaagcggac
caagctctcagctccctattggacttcaagccgagcgaatggggcctaccaccttttgaa
gatgtggtgaattga

DBGET integrated database retrieval system