KEGG   Phoenix dactylifera (date palm): 103702818Help
Entry
103702818         CDS       T03274                                 

Definition
(RefSeq) phosphatidate phosphatase PAH1
  KO
K15728  phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00561  Glycerolipid metabolism
pda00564  Glycerophospholipid metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Module
pda_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103702818
   00564 Glycerophospholipid metabolism
    103702818
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pda01009]
    103702818
Enzymes [BR:pda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     103702818
Protein phosphatases and associated proteins [BR:pda01009]
 HAD phosphatases
  Other HAD phosphatases
   103702818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LNS2 Lipin_N Lipin_mid
Motif
Other DBs
NCBI-GeneID: 103702818
NCBI-ProteinID: XP_017697238
UniProt: A0A2H3ZLF0
Position
Unknown
AA seq 880 aa AA seqDB search
MNVVGKVGSLISQGVYSVATPFHPFGGAVDVIVVEQQDGTYRSTPWYVRFGKFQGVLKGA
EKIVTITVNGVEANFHMYLDNSGQAYFMREVMSGSTDADSSGQAMNESNTPQSHQGDNID
NSVDDHENIFDENKGEVENDDQLYRFQDQQASPDSSAGSSGFGNYHYGSLDEVEDMVKES
NESNSEMVLVSVDGHVLMAPISSNEENTENVQLSTPQFHLGPGGEGSGEDFRTSGVVWEA
GLFGDLDASTTKDTDVPCNQVEDSKDCREVSVHVEEAHHFGNRETEQEDAGVGLTKDDMF
KSCLDLMAQAEGDMQIEGSSAVELDPKVVSEYSQEITSLSGIALAEMTASTDPNCRGDAS
QPVNVETEESQDDVSVDLNQKDEVVGADVFLQNSNQLFCEESWSKSMENESSDRKHVSGE
NISEEWGDFSVHSVSNDKEHMGTIAEGSVTEEESNETESPGLQRSFSGLGFDISLCGNLL
RPGMGFNSAGEAFEAHRISEESFRASGPSIIKNGNLIVRFEGKYLPWDEAAHIILGKAVF
GPNFSVEPKDSILVEHEDTLKSREETHEVSPSFSRRWRLWPIPFRRAKSLQHSNSNSSEE
LFVDSESGLQSPNTEQSTHVGTNQSPRKQFIRTNIPTNEQIASLNLKEGQNMIAFSFSTR
VLGKQQVDAHIYLWKWNTRIVISDVDGTITKSDVLGQFMPLVGKDWTQSGVARLFSAIKE
NGYQLLFLSARAIVQAYLTRSFLLNLKQDGKALPNGPVVISPDGLFPSLYREVIRRAPHE
FKIACLEDIRALFPSDYNPFYAGFGNRDTDELSYRKIGIPKGKIFIINPKGEVAINHCID
VKSYTSLHTLVDDMFPPSLVEQEDFNSWNYWKMPLPDIEY
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtggtgggcaaggtcgggagccttatctcccaaggtgtctattccgttgcgacc
cctttccaccccttcggtggtgctgttgatgttattgttgttgagcaacaagatgggacc
taccgcagtacgccatggtatgtgcgatttgggaagttccagggtgttcttaaaggtgct
gagaagattgtgactattactgttaatggtgtcgaagccaatttccatatgtatcttgat
aactcaggccaggcctatttcatgagagaagttatgtcaggaagtactgatgcagattcc
agtggccaggctatgaatgagtccaacactcctcagtcacatcagggtgataatattgac
aattctgttgatgatcatgagaatatctttgatgaaaacaaaggggaggttgagaatgat
gatcagctatacaggtttcaagatcagcaggcttccccagatagttcggcaggatcatct
gggtttggcaactatcactatgggagtttagacgaggtggaggatatggttaaagaatcc
aatgagtccaattcggaaatggtgttggtcagtgtggatggacatgtcctcatggcaccc
atctcttcgaatgaagagaacacggaaaatgtgcaattgagtaccccgcaattccatcta
ggacccgggggggaaggctctggtgaagattttaggacaagcggagttgtgtgggaagct
ggtttgtttggtgatctagatgcatctacaacgaaagatacagatgttccttgtaatcag
gtggaagactctaaagactgtagagaggtttcagtccatgttgaagaggctcaccatttt
ggtaaccgtgaaactgaacaagaggatgcaggagtgggtttgactaaagatgatatgttc
aagagttgtttagatttaatggcccaggctgagggtgatatgcaaattgagggttcttca
gccgtggaattggacccaaaagttgtctctgaatattcgcaggaaattacttccttgagc
ggcattgctttggcggaaatgacagcaagcactgaccctaactgtagaggtgatgcatca
cagcctgtaaatgtagaaactgaagaatcacaagatgatgtctctgttgaccttaatcag
aaagatgaggtggttggtgcagatgtatttcttcaaaattccaatcagttattctgtgag
gagtcatggagcaaaagcatggagaatgaatcttctgataggaagcatgtgagtggtgaa
aacatttctgaggagtggggtgatttttcagtccattcagtaagcaatgataaggaacat
atgggaacaattgcagaggggtctgttactgaagaagaaagcaatgaaactgagagtcct
ggattacaaaggagtttctctgggttgggctttgatatttccctttgtgggaacttactg
cgacctggtatgggctttaattctgctggggaagcctttgaagcccatcgtatttccgag
gagagcttcagggcatctggaccatccatcattaagaatggtaacctcattgttagattt
gaaggcaagtatttgccgtgggatgaagctgctcatatcattcttgggaaggctgtgttt
ggtccgaacttttcagttgagccgaaggattcaatcctggtggaacacgaggacacgttg
aaatccagagaagagacccatgaagtctcaccttctttcagccgcagatggagactgtgg
ccgattccatttaggagggccaagtcccttcagcacagtaatagtaactcaagtgaggag
ctttttgttgattcagaatctggattgcagagcccaaacacagaacaatccacacatgtg
ggcacaaatcaatctccgcgcaagcagttcatacggacaaatattccaactaatgagcag
attgcttctttaaatctgaaggaaggtcaaaatatgatagccttcagtttcagcacaaga
gttctagggaagcaacaggtcgatgcacacatttatttgtggaagtggaatacacggata
gtcatatctgatgttgatggaaccattaccaagtctgatgtcctgggccagttcatgcct
ctagttggaaaggactggactcaatctggggtagcacgacttttttctgcaataaaggaa
aatggctatcaactactgttcctgagtgcaagagctattgtccaggcatatctcaccaga
agctttctcctcaatctgaaacaggatgggaaagcactacctaacgggcctgtcgtaatt
tcacctgatggattgttcccttcgctgtatcgagaagttatacgtagagcacctcatgag
ttcaagattgcatgtttggaggacattagagcactttttccttctgactacaacccattc
tatgcgggctttgggaacagagacacagatgagcttagttacaggaaaattggaattcca
aaaggaaaaatatttatcattaatccaaagggggaagtggctatcaatcactgcattgat
gtgaaatcttatacctccttgcatacactggtcgatgacatgttcccaccgtcactggtc
gagcaggaggatttcaactcttggaattactggaaaatgccattgcccgacattgaatac
tag

DBGET integrated database retrieval system