KEGG   Phoenix dactylifera (date palm): 103703918Help
Entry
103703918         CDS       T03274                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00020  Citrate cycle (TCA cycle)
pda00640  Propanoate metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103703918
   00640 Propanoate metabolism
    103703918
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pda04147]
    103703918
Enzymes [BR:pda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103703918
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103703918
Exosome [BR:pda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103703918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig GARS_A
Motif
Other DBs
NCBI-GeneID: 103703918
NCBI-ProteinID: XP_008785202
UniProt: A0A2H3XKM8
Position
Unknown
AA seq 422 aa AA seqDB search
MVRGSIGKLVSGSLSLAGRWQQQQLRRLNIHEYQGAGLMSKYGINVPRGVAVGSAEEVKK
AIQDVFPNEKELVVKSQILAGGRGLGTFKSGLKGGVHIVKTEEVEDIAGKMLGQILVTKQ
TGPQGKIVSKAYLCEKLSLVNEMYFAITLDRATAGPLIIACRKGGTSIEDLAEKFPDMII
KVPVDVFKGITDEDAGKVVDGLAPKVADRNACIEQVKKLYKLFCECDCTLLEINPIAETS
DNQLVAADAKLNFDDNAAFRQKEIFALRDPSQEDPREVAAAKADLNYIGLDGEIGCMVNG
AGLAMATMDIIKLHGGTPANFLDVGGNASEGQVVEAFKILTSDDKVKAILVNIFGGIMKC
DVIASGIVNAAKQVSLKVPVVVRLEGTNVDQGKRILKESEMALITAEDLDDAAEKAVIAA
ST
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtcaggggatctatcggaaagctcgtatccgggtctctctcgctcgccggcagatgg
cagcagcaacagctgcggcgtctcaacatccacgaataccagggtgctggattgatgtca
aaatatggaataaatgtaccaaggggagttgccgttggctctgctgaggaggtgaaaaag
gccatccaggatgttttccccaacgaaaaggagttggtagtgaaaagccaaattcttgct
ggtggccgaggcttgggaaccttcaagagcggacttaagggtggagtgcatattgttaaa
actgaagaggtggaagatattgctggtaaaatgctcggccagattctggttaccaaacaa
actggcccccaaggaaagattgtgagcaaggcatacttgtgtgagaagctatcacttgtt
aatgagatgtacttcgccatcacccttgaccgtgcaacggctggtccgctcatcatagct
tgtagaaagggaggaactagcattgaagatcttgcggaaaagtttcctgacatgatcatc
aaggtcccggttgatgttttcaagggaatcacagatgaagatgccggaaaagttgttgac
ggtttagcacctaaggtagcagacagaaatgcttgcatagaacaagtgaagaagctttac
aaactcttttgtgaatgtgattgcacgttgttggagataaatccaattgccgagacatct
gataaccagctagtagcagctgatgcaaagttgaactttgacgacaatgctgctttccgt
cagaaagagatatttgctctccgtgatccatcccaggaagatcctagagaggttgctgct
gccaaagccgatctgaactatattggattggatggagagattggatgtatggttaatggt
gcaggattggctatggctacaatggatataataaaattgcatggtggtactcctgccaat
tttcttgatgttggtggaaatgcgtcagaaggccaggtggttgaagcattcaaaatatta
acatctgatgacaaagtgaaggcgattttggtcaacatatttggtggaatcatgaaatgt
gatgtgatagcaagcggaattgttaatgcagccaaacaggtttcactgaaagtacccgtg
gttgttcgcttagaaggcaccaatgttgatcaggggaagagaattctcaaggagagtgag
atggccttgatcacggcagaagatttggatgatgctgcagagaaagctgtaatagccgcg
tcaacctaa

DBGET integrated database retrieval system