KEGG   Phoenix dactylifera (date palm): 103705321Help
Entry
103705321         CDS       T03274                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00450  Selenocompound metabolism
pda00970  Aminoacyl-tRNA biosynthesis
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103705321
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103705321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pda01007]
    103705321
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pda03016]
    103705321
Enzymes [BR:pda01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103705321
Amino acid related enzymes [BR:pda01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103705321
Transfer RNA biogenesis [BR:pda03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103705321
 Prokaryotic type
   Other AARSs
    103705321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 103705321
NCBI-ProteinID: XP_026659728
UniProt: A0A3Q0HYM1
Position
Unknown
AA seq 412 aa AA seqDB search
MQDEKELLENNCCPMHLKPCVRRKEDNYFFSLSKYQRRLEEFLLQNPDFVKPPFRLNEVQ
SWIKSGLRDFSISRSSVDWGITVPNDSRQTVYVWFDALLGYISALLEDGEKPGLQQAVSS
GWPASLHLIGKDILRFHAVYWPAMLMSAGLSLPSMVFGHGFLTKDGMKMGKSLGNTLEPK
DLVGRFGADAVRYFFLREVEFGNDGDYSEDRFINIVNAHLANTIGNLLNRTLGLLKKNCQ
SMLAFDSGIAAEGNPFKDTVEKLVEKVRYHYENLSLSSACESVLDIGTAGNSYMDERAPW
SGFKQGGASSEMAAKDLVIILEAMRIIAIALFPITPRLSLRIYMQLGFSKDQFEAVTWSD
TKWGGMKAGQIMADPKPVFARIESRKEGEDEVVQKSVKDKKKTSRSQGLVQA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgagaaagaattgcttgaaaacaattgctgccccatgcacttaaagccttgt
gtacgacgaaaggaggataactactttttttctctatcgaagtatcagcgaaggctggaa
gagtttttattgcagaatccagattttgtgaaacctccatttcgcttgaatgaggtgcaa
agctggattaagagtgggctgagagatttctctatatcccgctcgtctgtggactggggc
ataactgtgccaaatgacagtagacaaactgtttatgtctggtttgatgctttattgggg
tatatttcagcattattagaggatggagagaaaccaggtttacaacaagctgttagttct
ggttggcctgcttcattacacttaataggaaaggacatcttgcgatttcatgcagtttat
tggccagcaatgttaatgtcagcgggattaagtcttccaagcatggtctttggtcatgga
tttttgacgaaggatggtatgaagatggggaaatcattgggcaatactcttgaaccaaag
gatctggtgggtagatttggagctgatgctgtcaggtactttttcttgcgagaagtggaa
tttgggaatgatggggactattcagaggaccgtttcataaatatagtcaatgcacatctt
gcgaatacaattggaaaccttctcaaccgcacccttggacttttgaagaagaactgccag
tccatgttggcttttgattctggcattgcagcagaaggaaatccattcaaagatactgta
gagaagttggtggagaaggtgcgataccattatgagaatctctctttatcatctgcttgc
gaatctgtgttagatattggtactgctggtaattcatatatggatgaacgtgctccatgg
tctggttttaagcaagggggtgctagttctgaaatggctgcaaaggaccttgtaattata
ttggaggcaatgaggattatagcaattgctttgtttccaatcactccaagactatctttg
aggatatatatgcaacttgggttttcaaaggatcagtttgaagcagtgacctggagtgat
accaaatggggagggatgaaagcaggtcagataatggcagatcctaagccagtgtttgca
aggattgaaagtagaaaggaaggagaagatgaagtggttcagaagtcggtcaaggataag
aagaaaacttcgcgtagtcaagggcttgtacaggcttaa

DBGET integrated database retrieval system