KEGG   Phoenix dactylifera (date palm): 103706625Help
Entry
103706625         CDS       T03274                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00520  Amino sugar and nucleotide sugar metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103706625
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     103706625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 103706625
NCBI-ProteinID: XP_008788999
UniProt: A0A2H3XUJ9
Position
Unknown
AA seq 439 aa AA seqDB search
MKQLHKQPSLNQQHQIPTHTHTPSYSSKSAKQQTRSSSFLRSAASYLLREQRLLFVLAGV
IIASTFFLLSPYYHSSLSRLSSSSSDEGPHRFLPSFRHPSLDRSSTTKASVAGGGGGRRV
PVGLRKPALRIVVTGGAGFVGSHLVDKLLARGDSVIVLDNFFTGRKDNLVRHFGNPRFEL
IRHDVVEPILLEVDQIYHLACPASPVHYKYNPIKTIKTNVMGTLNMLGLAKRIGARFLLT
STSEVYGDPLEHPQKETYWGHVNPIGVRSCYDEGKRTAETLSMDYHRGAGVEVRIARIFN
TYGPRMCLDDGRVVSNFVAQALRKQPMTVYGDGKQTRSFQYVSDLVDGLVALMEGDHIGP
FNLGNPGEFTMLELAEVVKETVDPSATIEFKPNTADDPHMRKPDITKAKELLNWEPKISL
RQGLPLMVTDFRKRVNEEK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctccacaagcaacccagcctcaaccagcagcaccagatcccaacccacacc
cacaccccctcctactccagcaagtccgcaaagcagcagacccgctcctcctccttcctc
cggtccgccgcctcctacctcctccgtgagcagcgcctcctattcgtcctcgcgggcgtc
atcatcgcctccaccttcttccttctctccccctactaccactcatccctctcccgcctc
tcctcctcctcctccgacgaaggcccccaccgtttcctgccttccttccgtcacccctcc
ctcgaccgctcctcgacgaccaaggcgtccgtcgccggcggaggcggagggaggagggtg
ccggtggggctgcggaagccggcgctgcggatcgtggtgaccggtggggcggggttcgtg
ggcagccacctcgtggacaagctgctggccaggggggacagcgttatcgtcctcgacaac
ttcttcacggggcgcaaggacaatctcgtccgccacttcggcaatcccaggttcgagctg
atccgccacgatgtcgtcgagccgatcctcctcgaggtcgaccagatctaccacctcgct
tgcccggcctcgccggtgcactacaagtataatcccatcaagaccattaagacgaatgtg
atgggaaccttgaacatgctgggcttggcaaagagaattggagctcgcttcttgttgact
agtactagtgaggtttatggcgacccgcttgagcaccctcagaaagagacttattggggc
catgtcaatcctattggtgttaggagctgttatgatgaagggaaaagaacagcagaaact
ttgtctatggattaccatcgtggtgctggcgttgaggtgcgtattgcacgcatattcaat
acatatgggcctcgcatgtgcctagatgatggtcgtgttgtcagcaattttgttgcacag
gccctgcgtaaacagcccatgacagtttacggtgatggaaagcaaactcgaagttttcaa
tatgtttcagatttggttgatggattagtagcactgatggaaggcgaccacattggaccc
ttcaacttggggaatcctggggagttcaccatgttggagctggctgaggtagtgaaggag
acggtcgatccaagcgcaaccatagagttcaaacccaacactgctgatgaccctcatatg
agaaagccggatatcaccaaggcaaaagagctgctaaattgggagccaaagatttcattg
cggcaagggctgcccctgatggtgactgacttccgaaagcgtgttaacgaagagaaataa

DBGET integrated database retrieval system