KEGG   Phoenix dactylifera (date palm): 103708280Help
Entry
103708280         CDS       T03274                                 

Definition
(RefSeq) erlin-2-B-like
  KO
K23341  erlin
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pda04121]
    103708280
Ubiquitin system [BR:pda04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    103708280
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 103708280
NCBI-ProteinID: XP_017698583
UniProt: A0A2H3ZR17
Position
Unknown
AA seq 98 aa AA seqDB search
MEQKLMEKGSVKRQQEIENEMYIAREKSQTDANFYRVMKEAEANRLKLTPEYLELKFIEA
VANNSKIFFGDKIPNMIMDQRLLGNYLNSIARNEHAQM
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaagctaatggaaaaggggagcgtcaagaggcagcaggagattgagaacgaa
atgtacatcgcacgtgagaagagccaaacagacgccaacttttatagagtgatgaaggaa
gcagaagccaacagactgaaactcacgcctgaatatcttgagctcaaattcattgaagcc
gttgccaataattcaaagatcttctttggagacaaaatacctaacatgataatggatcag
agactgcttggtaactatcttaatagtattgcgagaaacgagcatgcacagatgtag

DBGET integrated database retrieval system