KEGG   Phoenix dactylifera (date palm): 103708852Help
Entry
103708852         CDS       T03274                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00010  Glycolysis / Gluconeogenesis
pda00562  Inositol phosphate metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103708852
   00562 Inositol phosphate metabolism
    103708852
Enzymes [BR:pda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103708852
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103708852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103708852
NCBI-ProteinID: XP_008792168
UniProt: A0A2H3Y2C8
Position
Unknown
AA seq 519 aa AA seqDB search
MAFAFSSILLALLLAPSLLVRPSAGESFDVRQHLSTVSRYGAAKDPNNANFVPSAIPDGC
KAVHLNLVARHGTRSPTKKRIKELDQLAIRLDTLLNDARESQKGSSLEKIPKWLSGWQSP
WKGREKGGELISKGEDELYHLGIRVREIFPALFDEEYHPDIFTIRATQVPRASASAVAFG
MGLFSGKGSLGPGQHRAFSVLSESRASDICLRFFDTCQTYKEFRSSQEPAVEKLKEPILD
EITSSLVTRFQLNFTRRDVASLWFLCKQEASLLEITDQACALFSAYEVSLLEWTDDLEVF
VLKGYGKAINYRMGVPLLQEVVQSMEQAIMAKEENRTPATFEKARLRFAHAETLVPFTCL
LGLFLEGSEFEQIQREQPLCLPPKPPQKRNWRGSIVAPFSGNNMLALYQCPGNNSSGVML
SGAHRSKYFVHVLHNEIPTPVPGCGNMDFCPFEVFKERVVNPHLKHDFHSVCNVKLELPG
AKIEQMKSCSLICKLSNLFRKLFIPKRSNTYTKIQKTEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgccttctcctccattctcctcgcacttctcctcgccccctctctcctcgtc
cgcccgtccgccggcgaatcgttcgacgtccggcagcacctctccaccgtgtccagatat
ggtgctgcaaaagaccccaacaatgccaattttgtgccttctgctataccagatggatgt
aaagcagtccacttaaatctcgtggcaaggcatggaacccgctctccgactaaaaaacgc
atcaaagagttggatcagttggctattcgcttggatactcttctgaatgatgcaagggag
tcacaaaaaggttcttccttggagaaaattccaaagtggttatcaggatggcagtcccct
tggaaaggaagagagaaaggtggtgagctaattagcaaaggggaagacgaattataccat
cttggaattagagtgagggaaatatttccagcattgtttgatgaggaatatcaccctgat
attttcacaataagggcaacccaggttcctcgagcttcagctagcgctgtggcatttggc
atggggctattttctgggaaaggaagccttggaccagggcagcatcgtgctttttctgtg
ctaagtgagagtcgtgcaagtgacatatgtctgcgtttttttgacacttgtcaaacttac
aaggaatttaggagcagtcaggagcctgctgttgaaaagctcaaagaaccgattttggat
gaaattacctcttcattagtcactcgtttccagctgaatttcacaagacgggatgttgcc
tccctttggtttctttgcaagcaggaagcatccttgttggaaattactgatcaagcttgt
gcgctgttcagtgcttatgaggtttctttacttgagtggacagatgacttggaggtattt
gtactaaaaggttatggtaaagccattaattatcgcatgggagtgccattactccaagaa
gttgttcaatcaatggagcaagcaatcatggctaaagaagaaaaccgcacccctgcaact
ttcgagaaggcaaggctccgctttgcacatgctgagacacttgtaccctttacctgtctg
ctcgggctctttcttgagggatctgaatttgagcaaatacaaagagagcaacccttatgc
ctgcctccgaagcctccccagaaaagaaattggaggggcagtattgtggcacctttttct
ggaaataatatgttggctttgtaccagtgtcctggtaataattctagtggcgtcatgctg
tctggagctcacagaagcaagtattttgtgcatgttctgcacaatgaaatcccaactccc
gtgccaggttgtggcaacatggatttttgcccatttgaggttttcaaggaaagagttgtc
aacccccatttaaagcatgactttcattcggtctgcaatgtaaagttggaattgccagga
gccaagatagaacaaatgaagtcttgttccctgatttgtaagttgtcaaatttattccgt
aaacttttcattccgaaaagatcgaatacatacaccaaaatccagaagacggaattgtga

DBGET integrated database retrieval system