KEGG   Phoenix dactylifera (date palm): 103709481Help
Entry
103709481         CDS       T03274                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00071  Fatty acid degradation
pda00410  beta-Alanine metabolism
pda00592  alpha-Linolenic acid metabolism
pda00640  Propanoate metabolism
pda01040  Biosynthesis of unsaturated fatty acids
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01200  Carbon metabolism
pda01212  Fatty acid metabolism
pda04146  Peroxisome
Module
pda_M00087  beta-Oxidation
pda_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    103709481
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103709481
   00592 alpha-Linolenic acid metabolism
    103709481
   01040 Biosynthesis of unsaturated fatty acids
    103709481
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103709481
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103709481
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     103709481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 103709481
NCBI-ProteinID: XP_008793066
UniProt: A0A2H3Y3Y3
Position
Unknown
AA seq 438 aa AA seqDB search
MATSTPKHGDHFKEVKSSHIGLPALDISAAFPQATPASIFPPSASDYYQFDDLLSPEEKA
LRRKVREVMEKEVAPIMAAYWEKAEFPFHVIPKLATLRLAGGTIKGYGCPGLSITGSAIA
TAEVARVDASCSTFILVHSSLAMLTIALCGSEAQKQKYLPSLAQLHTVACWALTEPDYGS
DASSLRTIATKVTGGWMIDGQKRWIGNSTFADVLVVFARNTSTNQINGFIVKKDAPGLRV
TKIENKIGLRIVQNGDILFKKVFVPDEDRLPGVNSFKDTNKVLAVSRVMVAWQPIGISMG
VFDMCHRYLKERKQFGAPLAAFQINQEKLVRMLGNIQAMLLVGWRLCKLYESGKMTPGHA
SMGKAWTSLKARETVSLGRELLGGNGILADFLVAKAFCDLEPIFSYEGTYDINSLVTARE
ITGFASFKPAVLAKASRL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcgactccgaaacatggtgatcatttcaaggaagtcaagagttcgcatatt
ggattgccagcactagatatctctgctgcatttcctcaggcaacacctgcatcaattttt
cctccatcagcatcagattattaccaatttgatgacctattgagtcctgaagaaaaggct
ttgcggagaaaagtccgagaggtcatggaaaaagaagttgctcccataatggcagcgtat
tgggagaaggcagagtttccttttcatgtaattcctaagcttgctaccttgcgtctcgca
ggcggaactataaagggttatgggtgccctgggctctctattactggaagtgctattgct
acggcagaagttgccagagtagatgcaagctgttcaacctttattttggtgcattcttcc
ttggcaatgcttactattgcattgtgtgggtcagaggcacaaaagcagaaatacttacca
tcattagctcagttgcatactgttgcttgctgggctttgactgagccggactatggaagt
gatgcaagctccttgagaaccattgccacgaaggtaacaggaggttggatgatagatggc
caaaaacgatggataggaaacagtacctttgctgatgtgttagttgttttcgctagaaac
acaagtaccaaccagataaatgggtttattgtgaagaaagatgcccctggattgagggtc
acaaaaattgaaaacaaaatcggtctgaggattgttcagaatggtgatattctctttaag
aaagtgtttgttcctgatgaagacaggttgccaggtgttaattcattcaaggacacaaac
aaggtccttgctgtttcacgtgttatggttgcatggcaacctattggcatatcaatgggc
gtatttgatatgtgtcacaggtacctgaaagagaggaagcaatttggagctccattggca
gcatttcagattaaccaagaaaagcttgttcgcatgcttggtaatattcaagcaatgctt
cttgttggttggcgcttatgcaaattgtacgaatctggaaagatgactccaggtcatgct
agcatgggaaaggcatggacttccttaaaggcaagggagactgtctctcttggtcgagaa
ttacttggtggaaatggaatcttggctgattttctagttgccaaggcattttgtgatctg
gagcctattttctcatatgaaggcacctacgatatcaacagtttggtgacagcgagagaa
atcacagggtttgcaagctttaaacctgctgtcctggccaaggcaagtcggctttaa

DBGET integrated database retrieval system