KEGG   Phoenix dactylifera (date palm): 103711046Help
Entry
103711046         CDS       T03274                                 

Gene name
ADH
Definition
(RefSeq) alcohol dehydrogenase 3
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00010  Glycolysis / Gluconeogenesis
pda00071  Fatty acid degradation
pda00350  Tyrosine metabolism
pda00592  alpha-Linolenic acid metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103711046 (ADH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103711046 (ADH)
   00592 alpha-Linolenic acid metabolism
    103711046 (ADH)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103711046 (ADH)
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     103711046 (ADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N IlvN
Motif
Other DBs
NCBI-GeneID: 103711046
NCBI-ProteinID: XP_008795241
UniProt: A0A2H3Y9C5
Position
Unknown
AA seq 442 aa AA seqDB search
MAMEVGRLMRCGVICPRGFPILNTKIHKVLKSMSRGGQVIRCQVNDSRGLATVQPKIRKV
EEIESTAGQVIQCRAAVAWEAGKPLVIEEVEVAPPKEKEVRLKILYTSLCHTDLYFWEAK
GQTPLFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKHEESNLCDLLR
INTERGVMISDGRSRFSMNGKPIYHFLGTSTFSEYTVIHSGCVAKINPSAPLDKVCVLSC
GISTGLGAALNVAKPPRGSTVAIFGLGAVGLAAAEGARIAGASRVIGVDRNPAKFDEAKK
FGITEFVNPMDYDKPVQEVLAEMTGGGVDRSIECTGNINAMISAFECVHDGWGVAVLVGV
PHKEAVFKTHPINFLNERTLKGTFFGNYKPRSHLPSVVEKYMNKELEVEKFITHTVPFSE
INKAFDYMLKGDGLRCIIRMDG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggaagttggtcgactcatgagatgtggagttatttgtcctaggggatttcct
atcttgaataccaaaatccacaaggtgctaaagagtatgagcagaggtggtcaagtcata
agatgccaagttaatgattccaggggacttgctactgtacagcccaaaatccgcaaggtg
gaagagattgaaagcacagctggtcaggtcatacaatgccgagcggcagttgcatgggaa
gctgggaagccattagtgatcgaggaggtcgaggttgctcctccaaaagaaaaggaagtc
cggctgaagatcctttacacttccctctgccacactgatctgtacttctgggaagccaag
ggccaaactcccttgtttcctcgaatctttggccatgaagcaggagggatcgtggagagt
gttggtgaaggcgtaacagatcttgcaccaggagaccatgtcctccctgtattcactgga
gaatgtaaagagtgcgctcactgtaagcatgaggagagcaatttgtgtgatctccttagg
attaacactgaaagaggggtgatgatcagtgatgggcggtccaggttctctatgaatgga
aaaccaatttatcattttctaggaacctccactttcagtgagtacactgtcatccattcg
ggctgtgttgccaagatcaacccctcggctccccttgataaagtctgtgttcttagctgt
ggcatttcaacaggtcttggtgcagctcttaatgttgcgaaaccaccaaggggttcgacg
gtggcaatttttggattgggtgccgtaggccttgctgctgctgaaggggccaggattgca
ggagcatcaagggttatcggtgttgatagaaatcctgcaaaatttgatgaagcaaaaaag
ttcggcatcactgagtttgtgaatccaatggactacgacaagccagtccaagaggtgctt
gctgaaatgactggcggtggagttgataggagcatcgaatgcacaggcaacataaatgcc
atgatatctgcgtttgaatgcgttcacgatggttggggtgttgctgtgttggttggggtg
cctcacaaagaagccgtattcaagacccaccctataaactttctgaatgaaaggactctc
aagggaaccttctttggaaactataagccccgaagccaccttccttcggttgtggagaag
tacatgaacaaggagctagaggtggaaaagttcatcacacacactgtacctttctctgag
atcaacaaggcctttgactacatgctcaaaggagatggccttcgttgcatcattcgcatg
gatggttag

DBGET integrated database retrieval system