KEGG   Phoenix dactylifera (date palm): 103716066Help
Entry
103716066         CDS       T03274                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00260  Glycine, serine and threonine metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103716066
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     103716066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Pyridoxal_deC Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 103716066
NCBI-ProteinID: XP_008802139
UniProt: A0A2H3YQI1
Position
Unknown
AA seq 359 aa AA seqDB search
MVMRIVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHRFESEMARVMGKEAALFVP
SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDLDQ
IEAAIRHPEGALYYPTTRLICLENTHANCGGRCISSEYTDRVGEIAKKHGLKLHIDGARI
FNASVALGVPVHRLVQAADSVSVCMSKGLGAPIGSVIVGSSEFITKARRLRKTLGGGMRQ
VGVLCAAAYVALRDNVGKLEDDHKKAKLFADGLKQIKELTVDTSSVETNMVFLDIVESSH
ISPERLCQVLEEHGVLAMPASSTSVRLVVHHQILESDIRYVLACMKQAVQELSTDGITK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgagaattgtagacctccgatctgacacggtcacgaaacccacggaggcgatg
cgagctgccatggcgagcgccgatgtggacgacgacgttttgggctccgaccccaccgcc
caccgcttcgaatccgagatggcgagggtcatggggaaggaagccgctctcttcgtgccc
tcgggcaccatgggaaatctcatatcggtgcttgtccattgtgaggtcaggggcagcgag
gtcatccttggggacaattcccacatacatgtctacgaaaatggaggcatatcgaccatt
ggaggcgtgcacccgaggaccgtgaagaacaatcccgacggcaccatggatctcgatcag
atcgaagcagctattaggcatcccgagggagcactctactacccaactactaggttaatt
tgcttggagaatacgcatgctaattgtgggggaagatgcatttcttcagaatatacagac
agggtaggagagatagctaaaaagcatggtttaaagcttcatattgatggagcacgcatc
tttaatgcttcagttgcactgggggttcctgttcataggctggtgcaagctgctgactcg
gtttcggtgtgcatgtcaaaaggattgggtgctccaattggatctgttattgtaggctca
agcgagtttattactaaggctagaaggcttaggaaaaccttaggtggtgggatgagacag
gttggagtcctttgtgcagcggcttatgttgctttgcgagataatgtgggaaagcttgag
gatgatcacaaaaaggccaaactgtttgcagatggattgaaacaaatcaaagaactaact
gttgatacatcttcagtggagacaaatatggtatttttggatattgtagagagttcgcat
atatcacctgaaaggctctgtcaagtcctggaagagcatggtgtacttgcaatgccagca
agctccacaagtgtcaggcttgtcgtccatcaccaaattttagagagtgacatccgctat
gtactggcatgtatgaagcaagctgttcaagaattatcaactgatggtatcacaaaatga

DBGET integrated database retrieval system