KEGG   Phoenix dactylifera (date palm): 103717225Help
Entry
103717225         CDS       T03274                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 2, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00071  Fatty acid degradation
pda00592  alpha-Linolenic acid metabolism
pda01040  Biosynthesis of unsaturated fatty acids
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01212  Fatty acid metabolism
pda04146  Peroxisome
Module
pda_M00087  beta-Oxidation
pda_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103717225
   00592 alpha-Linolenic acid metabolism
    103717225
   01040 Biosynthesis of unsaturated fatty acids
    103717225
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103717225
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     103717225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 103717225
NCBI-ProteinID: XP_008803753
UniProt: A0A2H3YTW8
Position
Unknown
AA seq 691 aa AA seqDB search
MDDPTPDGDSSPAVRRIRQLLLHIRHPSAPSPSSVAGEGQLAALPCGSRENKVAAVSVAE
LAQYMRGRHREIQERVFEFFRSRPDLQTPVEISTADHRELCMRQLTALVRDAGIRPFRYV
LEDPSLYFAISEAAGGIDISLGIKMGVQYSLWGGSVINLGTKKHRDKYFDGIDNLDYPGC
FAMTELHHGSNVQGLQTTATFDPVTDEFVINTPNDGAIKWWIGNAAVHGKFATVFAKLIL
PLQGMGGGSADMGVHAFIIPIRDLETHSVLPGIEINDCGHKIGLNGVDNGALRFHSVRIP
RDNLLNRFGDVSRDGKYTSSLPSINKRFAATLGELVGGRVGLAYSSVGVLKIAVTIAVRY
SLLRQQFGPPKKPEVSILDYQSQQHKLMPMLASTYAFHFATLYLVDKYSEMKKSHEDEAV
SDVHTLSAGLKAYITSYTAKSLSTCREACGGHGYAAVNRFGTLRNDHDIFQTFEGDNTVL
LQQVAIDLLKQYKEKFQGGTLTATWSYLRESMASYLSQPNPLTARWEREDHLRDPKFQLD
AFRYRTSRLLQTVAVRLQKHSTRLGGFGAWNRCLNHLLTLAESHIESIILAKFINSVQSC
PDKNTRHVLKLVCDLYALDRIWHYIGTYRNDDYVAPNKAKAIHKLTEYLSFQVRGVAREL
VDAFDLPDYVTRAPIGMSSEAYAHYTQYAGF
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggacgacccgacgcccgacggcgactcctccccggcggtccgccgcatccggcagctc
ttactccacatccgccacccctctgctccctccccttcatccgtcgctggcgagggacag
ctggcggcgctcccctgcggcagccgggagaacaaggtggcggcggtgagcgtggcggag
ctggcgcagtacatgagggggaggcaccgggagatccaggaaagggtattcgagttcttc
cggtcccggccggacctccagacgccggtggagatctccactgccgaccaccgcgagctc
tgcatgcgccagctcaccgccctcgtccgggacgccggaatccgccccttccgctacgtc
cttgaggatccctccctctatttcgccatctccgaggccgccggcgggatcgacatctct
ctcgggatcaagatgggcgtccagtacagcctttggggaggctcagtgatcaacctagga
accaaaaaacacagggataaatactttgatggaattgacaatttggactatcctggttgc
tttgctatgacagaacttcatcatggctccaatgttcaaggccttcaaacaactgctacc
tttgatcctgtcactgatgagtttgtaatcaacacaccaaatgatggagccatcaagtgg
tggattggaaatgctgcagtccatggaaaatttgcaactgtttttgcaaagttgattttg
cctctccaaggaatgggaggaggttctgctgatatgggtgttcatgctttcattattccc
ataagagaccttgaaacccattctgttcttcctgggattgaaataaatgattgtggccac
aaaattggcctaaatggtgtagacaatggtgcattgcgattccactctgtgaggattcct
cgagataatcttcttaaccgatttggagatgtttcacgtgatgggaagtacactagcagc
ctcccatccatcaataaaaggtttgcggctaccctaggagaacttgttggagggagggtt
ggccttgcatactcctctgtgggtgttctgaaaatagcggttactattgctgtgagatat
tctttgcttcgccagcaatttggtcctcccaagaagccagaggtcagtatattggattac
cagtctcagcagcacaaactcatgccaatgttggcatcaacatatgccttccacttcgct
actctgtatttggtggataagtactctgagatgaagaaatcacatgaggatgaagctgtt
agtgatgttcatactctttcagcaggcctcaaagcttatatcacatcatatactgctaag
tcactgagcacatgtcgagaagcctgtggtggtcatggttatgcagctgtgaaccgtttt
ggtaccttgcggaatgaccatgacatatttcagacatttgaaggggacaacacagttctt
ctgcagcaggttgccatagacctcttgaagcagtacaaggaaaaatttcaaggagggact
ctcacagctacatggagttacttgagagagtccatggcttcatatttatcccaaccaaat
cctctgactgctcgctgggaaagagaagaccatttgcgagatcctaagttccagctggat
gcatttagataccgaacatcacgattacttcaaactgttgccgtacggctgcaaaaacat
tccacgagacttggaggctttggagcatggaacagatgtttaaatcacctgctgacactc
gcagagtcacacatcgagtcaatcatcctggcaaagttcatcaactctgtacaaagctgt
cctgataagaacacacgtcatgttctgaagctagtctgtgacttatatgcattggatcgt
atatggcactatattggaacatatcgtaatgacgactacgtggccccaaacaaagcaaag
gcaattcacaagctgacagagtacctgagtttccaggtgagaggggttgctagagaactt
gttgatgcatttgatcttcccgattatgtcacccgtgctcctattggcatgtcatcggaa
gcatatgctcactacacacagtacgcgggcttctag

DBGET integrated database retrieval system