KEGG   Phoenix dactylifera (date palm): 103717308Help
Entry
103717308         CDS       T03274                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial isoform X1
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103717308
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     103717308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 NAD_binding_8 DAO Pyr_redox_3 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 103717308
NCBI-ProteinID: XP_008803854
UniProt: A0A2H3YU48
Position
Unknown
AA seq 579 aa AA seqDB search
MRFSAFFFDGASRAFHHRPTFSKLVVILAASGGGLVAYADSKSDHAIESSRVAPKKKVVV
LGTGWAGTTFLKNLDSSLYDVQVVSPRNYFTFTPLLPSITCGTVEPRSIVEPIRRIIKKK
GGEIKFWEAECFKIDPTSKKIHCRSDIGTNLDGNGEFLLDYDYLVIAIGARANTFNTPGV
VEHCHFLKEVEDAQKIRRSVMDCFERASLPNLDAEERKRILHFVIVGGGPSGIEFAAELH
DFVTEDLFKLYPMVQDLVKISVIEAGEHILTMFDKRITKFAEEKFQRDGIEVKTGLRVVE
VADKNITMTHKSTEKMSVPYGMVVWSTGIGTRPVIMDFMKQIGQVNRRVLATDEWLRVHE
CNGVYALGDCATISQRKVMEDISAIFKVADKDNSGTLTVKEIQDVLDDICIRYPQVELYL
KSKQMSDIVDLIMDSKGDVEKESVELDIEEFKRALANVDSQVKNLPATAQVAAQQGNYLA
KCFNKMKDCEESPEGPLRMRESGRHHFRPFRYKHFGQFAPLGGEQTAAQLPGDWISIGHS
TQWLWYSVYASKQVSWRTRALVISDWMRRFIFGRDSSCI
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctcggccttcttctttgacggcgcctcccgcgccttccaccatcgccctacc
ttctccaagctcgtagtcatcttggccgccagtggtggaggtcttgtggcatatgctgac
tcaaaatcagaccatgccattgaatcatctcgagtagcacccaagaaaaaggtggtagtt
cttggtactggttgggctggcacaactttcttgaaaaatctagatagctcattgtatgat
gtacaagtggtatcacctcgtaattactttacatttacccctttgctacctagcatcaca
tgtggaacagttgaaccacgcagcattgttgagccgattcgcagaatcataaaaaagaag
ggaggagaaataaaattttgggaagctgaatgtttcaaaatcgatccaacaagcaaaaaa
atccactgtcgatctgatattggcacaaatttggatggaaatggtgaatttcttcttgat
tatgactatctggtgatagcaattggagccagggcaaatacatttaacacccctggtgta
gtggaacattgtcactttctgaaggaagtagaggacgctcagaaaattcgtaggagtgta
atggactgttttgagagggccagtcttccaaaccttgatgcagaagagaggaagaggatt
cttcattttgttattgttggtggtggtccatctggtattgaattcgctgcagagttgcat
gattttgttactgaagatttatttaagttataccctatggttcaagacttggtgaaaata
tctgttattgaagctggagagcatatcttgaccatgtttgacaagaggatcactaaattt
gcggaagagaagttccaaagagatggtattgaagtgaaaacagggcttagggttgtggag
gtggccgacaaaaacatcacaatgacacacaaatcaactgaaaaaatgtctgtaccatat
ggaatggttgtctggtcaactggtatcgggacacgccctgtcataatggattttatgaaa
caaattggtcaggttaaccggcgtgtgttagcaactgatgagtggctgagagtccatgaa
tgcaatggtgtatatgcacttggtgattgtgccaccataagtcaacgaaaagtcatggaa
gacatctcagcaatctttaaggttgcagacaaggacaattctggaactttaactgtgaaa
gaaatccaagatgttttagatgatatttgcataagataccctcaagtggaactctatttg
aagagcaagcaaatgagcgacattgttgatttaattatggattccaaaggtgatgttgag
aaggaatctgtagaactggacatagaagagttcaaaagagctcttgcaaatgtagattca
caagtcaaaaatcttcctgcaacagctcaggttgctgcacaacaaggcaattatcttgct
aaatgttttaacaaaatgaaggactgtgaagagagtcctgaaggtccactgcgcatgaga
gaatcaggtcgccatcactttcgccccttcaggtataagcattttgggcaatttgcccca
ttgggcggagaacagactgctgcacagctgcctggagattggatctctataggccacagt
acccagtggctctggtattctgtgtatgcaagcaaacaagtcagctggcgcacgagagca
ttggtaatttctgattggatgaggcgtttcatatttgggagggactcaagttgcatataa

DBGET integrated database retrieval system