KEGG   Phoenix dactylifera (date palm): 103717556Help
Entry
103717556         CDS       T03274                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK3 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pda01001]
    103717556
   01009 Protein phosphatases and associated proteins [BR:pda01009]
    103717556
Enzymes [BR:pda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103717556
Protein kinases [BR:pda01001]
 Serine/threonine kinases: Other
  Wnk family
   103717556
Protein phosphatases and associated proteins [BR:pda01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103717556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal SlyX FYVE_2 NCD1
Motif
Other DBs
NCBI-GeneID: 103717556
NCBI-ProteinID: XP_008804212
UniProt: A0A2H3YVP8
Position
Unknown
AA seq 631 aa AA seqDB search
MVADSCSSDQEQDEPDAVFVEVDPSGRYGRYREILGKGAFKTVYKAFDELEGIEVAWNQV
KVADVLRNSDDLERLYSEVHLLKTLKHKNIIKFYNSWVDTKHDNINFITEVFTSGTLHQY
RKKHKHVDVRALKNWSRQILSGLLYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLA
AILRHAHSAHSVIGTPEFMAPELYEEEYNELVDIYAFGMCLLELVTFEYPYSECTNAAQI
YKKVTSGVKPASLAKVKDPTIKQFIEKCIASASERSPARELLMDPFLLSDDNVTSYACAK
EPSITGRDFTVEGQRKDIKTIFLKLRIADSTGQVRNIHFPFDIEEDTSISVATEMVAELD
LTDQDVTTIAAMIDAEISAHVPGWMAGEADGHVNELASDSHDSEGEDVHSPLPNESDNPL
VLEQLPSGRKYWCSPRRTGEESPPWPTQSNVSAELNSHASDDVPVEVCEGKDVSLNNNDQ
REYHSNGSTSSNQQKDSPHSNGSGKDNLEIDSPSASPDLPNPSPADMVNQDNEVVSLCHL
CYNQHGATDEQCGIDDEQLPPDTLLESESEDVRSVVQKLENLLVQQQNEIDELKKKHEMA
IADVLKGLPPHLCTRILDKFDLKINNNKVHC
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggtagcagattcgtgctcgtccgaccaggagcaggacgagccggacgccgtgttcgtg
gaggtcgatccctccggtcgctatggccggtatcgtgaaatattaggaaagggtgctttc
aagaccgtctataaagcatttgatgaattggaaggcatagaagttgcttggaatcaggtg
aaggtggctgatgtgctgcggaattcggatgacttggagcgcctctattctgaagtccac
ttgcttaagactctgaagcacaagaatataatcaagttttacaactcgtgggttgacacc
aagcatgacaatatcaacttcatcactgaagtcttcacatccgggacattacaccagtat
cgcaagaaacacaagcatgtagatgtaagagcattgaagaattggtctagacaaatattg
agtggccttctatacctccacagtcatgaccctccagttattcacagggacttgaaatgt
gacaatatatttgtgaatggaaaccagggtgaggtgaagattggtgaccttggattggca
gccattcttcgacatgctcattcagctcacagtgttattggtacgccggagttcatggct
ccagagctgtatgaggaagaatataatgagttggttgacatttatgcatttggcatgtgc
ttactggagctggtgacatttgagtacccttattcggaatgtaccaatgcggcacaaata
tataagaaggtgacatcgggagtcaagcctgcatcattggcaaaggtgaaggaccctaca
attaaacaatttatagaaaaatgcattgccagtgcttctgaacgatcgcctgctagagaa
ttactaatggatccttttctgctatcggatgataatgttaccagttacgcatgtgcaaaa
gagccgtcaattactggccgagatttcacagtggagggtcaacgcaaagatataaagacg
atatttctcaagctacgaattgcagattcaacaggtcaagttcgtaacatccacttccca
tttgatattgaagaagacacatcaatcagtgttgccactgaaatggttgctgaactagac
cttacagatcaagatgttacgaccattgctgcaatgatagatgcagaaatatcagcccat
gttccaggatggatggcaggtgaagctgatggtcatgtcaacgagttagcttcggatagc
catgactctgaaggtgaagatgtacattctcctttgcccaacgaatcagataatcctcta
gttctagaacagctaccttctggtcggaagtactggtgttctcctaggagaactggtgag
gagtctccaccatggcctacacagtcaaatgtatctgctgaattgaattcgcatgcaagt
gatgatgtacctgtggaggtttgtgaagggaaagatgttagcttaaataataatgaccag
agggaatatcactctaatggaagcacttcatctaaccagcagaaagattccccccattct
aatggcagtggcaaagacaatttggaaattgattctccatcagcttctcctgatctacca
aacccatccccagctgatatggttaatcaagataatgaagtagtttctttatgccacttg
tgttacaatcaacatggagccactgatgagcagtgtgggattgatgatgaacagttgcct
cctgatacattattggagagtgaatctgaggatgtgagatctgttgttcagaagttagag
aatttgttggtccagcagcagaacgaaattgatgaattaaaaaagaagcatgagatggct
atagcagatgttttaaaaggactgcctcctcatctttgtactaggatattagataaattt
gacttgaaaattaataataataaggtccattgttag

DBGET integrated database retrieval system