KEGG   Phoenix dactylifera (date palm): 103717625Help
Entry
103717625         CDS       T03274                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 2/3/4 isoform X1
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pda03016]
    103717625
Enzymes [BR:pda01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     103717625
Transfer RNA biogenesis [BR:pda03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    103717625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Met_10 Kelch_1 Kelch_5 Kelch_6 Kelch_4 Kelch_3 Kelch_2 DNA_methylase MTS Methyltransf_15 Trm5_N
Motif
Other DBs
NCBI-GeneID: 103717625
NCBI-ProteinID: XP_008804307
UniProt: A0A2H3YV81
Position
Unknown
AA seq 1049 aa AA seqDB search
MEFEKRKAQALAAMAAPRPDKSPKGTVDAPIVPLLDAINRHPSFFTTSSCSGRISILAHR
TNPPPSSADATAGNPKLEAAAPKKKKKAGGGCWLFVSHDSADPEAIVDLLFGDRRDSEGG
DLVFRFEPLIVAVECRDLASAQSLVSTAISCGFRESGMTSIQKRIMVAIRCSIRLEVPLG
QIGFIMISPEYVRYLVRIANDKMEANRKRTDGFLHVLQSKVLPGPGKEMIDSNKKGLEQI
ADKGFSLDFEAKPNVVLSEISIENGTSKSHTEDNILGFIKDRCDSEPAGYSGEDKCAVAS
CKNSLKVSDPLHDKEIGYSHKEIADKDSNIELSGTPKCFLSVVMLKIVGEPIEKLFLWGQ
SACASNNGGQEHILVFGGFGGVGRHERRNCSLVLDPQSGLLSEINSTKPPSPRLGHTASM
VGREIYVIGGRGGPSQILNDVWVLDTTENRWSLLECTGSAFNPRHRHAAAAVGSNIYVFG
GLNNEVIYSCMNVLNTQTLQWSNVSIQGDWPCARHSHSLVASGPQLFMFGGYDGEKALGD
LYSFDVRTLQWRKEETSGRAPSPRFSHSMFIYKNYLGIIGGCPVRQQYQELALLNMHHLV
WMHVTIDSLGGDLWVRSSTCLIGEDLVIVGGGASCYAFGTKFNEPMKIDLHLLESLHNLP
SDKENKSFLQFHDTHGNMNLQQDKHVDGMLDSSDVNLRIDISTNEDGHDVDGEHLVIKLE
KKYAKPVKDILKKFGWLDLTRKVRPSQDGCHIYLPVSRNFYAFYVEEQFNSVNNFDNLEA
FYQLGEFSLKELSVNEVSQSTALNFLLSCGGSLLDDDVVCMRKVHKSPEKMIKESVCSML
RIKRMPLQLLEQLPTRWEHLGDIVVLPKTSFKDPIWDSIGKELWPIVAKALGANRLARQG
RILPTGTRDSTLEILVGDNGWVTHQENGILYTFDATKCMFSSGNLSEKLRMASLDCRDEI
IVDLFAGIGYFVLPFLVKARAKLVYACEWNPHALKALEHNINANSVADRCVILEGDNCVT
APKGVAHRVCLGLLPSSECSWVTAVRALR
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgagaaaaggaaggcgcaagccctggccgccatggcggcgccgcggccggac
aagtcccccaagggcacggtggacgcccccatcgtccccctgcttgacgctatcaatcgc
cacccctccttcttcaccaccagctcctgctccggccgcatttcgatcctcgcacaccga
accaacccgcccccttcttccgccgacgcgaccgcgggaaaccctaaactcgaggctgcg
gcgcccaagaagaagaagaaggccggcggaggttgttggcttttcgtctcgcacgactcc
gccgacccggaggccatcgtcgacctcctcttcggcgaccgccgggattccgagggaggg
gatctggtgttccggttcgagcccctcatcgtggccgtcgagtgccgggacctcgcctcg
gcgcagtcgctcgtctctactgctatttcttgcgggtttagagagtccggtatgacaagc
atacaaaaacgtataatggttgccatacgatgttctatacgtttggaggtaccattgggc
caaattggttttattatgatttcaccagagtatgttcggtaccttgttaggattgctaat
gataaaatggaggcaaacagaaagagaacggatggctttcttcatgttttgcaatctaag
gttctcccaggaccaggaaaggagatgattgattctaataaaaagggtctagaacagatt
gccgataaaggattttcattagattttgaagctaagcctaatgtcgtattgtcggagata
tcaattgagaatggcacttcaaagtctcataccgaagataatatcttgggcttcatcaaa
gatagatgtgattccgaacctgctggatattctggagaagacaaatgcgctgttgcttcc
tgcaagaactcactaaaagtatctgatcctttacatgacaaggaaattggatacagccat
aaagagatagctgacaaagattctaacatagagttgtcaggaacaccaaagtgctttctt
tccgttgtcatgttaaagattgttggcgagccgattgagaagctcttcctctggggtcaa
tcagcttgtgcttcaaacaatggagggcaggaacatatccttgtctttggtggctttgga
ggcgtaggacgacatgaaagaagaaattgctccctggtgcttgatccccagtctggcctg
ttaagtgaaataaattctacaaaacccccatctccacgcttgggtcatacagcctccatg
gtggggagagagatttatgttattggaggaaggggtggtccttctcaaattcttaatgat
gtctgggttctagacaccactgaaaataggtggtcattattagaatgtactggcagtgct
tttaaccctaggcaccgccatgcagctgcagctgtaggctcaaatatatatgtctttgga
ggtcttaataatgaagtgatatattcctgcatgaatgtcttaaacactcaaactcttcag
tggagcaatgttagtatccaaggagattggccctgtgcacgtcattcacattctttggtg
gccagcggccctcagttgtttatgtttggaggttatgatggtgagaaggcactaggcgac
ctctacagttttgatgttagaacattacagtggagaaaagaggagacatctgggagagct
ccttctccaagattctcacattctatgtttatctataaaaattatcttgggatcatcggc
ggttgccctgttaggcaacagtatcaagaattggctttattgaacatgcatcatcttgtc
tggatgcatgtgactattgactctcttggtggagacctttgggttcgcagctcaacctgt
cttattggcgaagatcttgttattgttggtggtggagcatcatgttatgcatttggaaca
aagtttaatgagccaatgaaaattgatttacatttgttagagtctctacacaacctccct
tcagataaggaaaataagtcatttttacagtttcatgacacccatggaaacatgaatcta
caacaggacaagcatgtagatggcatgcttgatagttctgatgtaaatcttaggattgac
atttctaccaatgaagatgggcatgatgtggatggggaacaccttgttataaaacttgaa
aaaaagtatgctaaacctgtgaaggatatattaaaaaaatttggatggttggatcttact
aggaaggttcggccaagtcaggatggatgtcatatttatttaccagttagcagaaatttc
tatgccttctatgtggaagagcaatttaattcagtaaataactttgataatttggaagca
ttttatcaactaggagaattttctttgaaggagctttctgtaaatgaggtttctcaatca
actgcattgaattttttgttgtcatgtggtggttctttactagacgatgatgtagtctgc
atgagaaaggttcacaaatctcctgaaaagatgataaaagaatcagtttgctccatgctg
aggataaaaaggatgcctctgcagctgttggagcagttgcctacaaggtgggaacatctt
ggggatattgttgtgctaccaaagacatcttttaaggatcctatatgggactctataggg
aaggaactttggcctatagttgccaaagcgcttggtgctaatcgtcttgcacggcaaggt
cgaattttgcctactggaacaagagacagcactcttgaaattcttgtgggagacaatggg
tgggttactcatcaagagaatggaatcctttatacatttgatgcaacaaaatgtatgttt
tcctccggaaacctttctgagaagcttcgtatggctagtctagactgtagagatgagatt
attgtggatctatttgctggaattggatactttgtgcttccatttcttgtcaaggctagg
gcaaaactggtttatgcatgtgagtggaatcctcatgctttaaaggctcttgaacataat
atcaatgcaaattctgtggcagatcggtgtgtcatacttgaaggagataattgtgtcaca
gcacccaaaggtgtcgcgcatcgtgtttgccttggtctcctaccatcaagtgagtgtagt
tgggttactgctgtgagggctttgaggtaa

DBGET integrated database retrieval system