KEGG   Phoenix dactylifera (date palm): 103718615Help
Entry
103718615         CDS       T03274                                 

Definition
(RefSeq) uncharacterized protein LOC103718615
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00230  Purine metabolism
pda00240  Pyrimidine metabolism
pda00760  Nicotinate and nicotinamide metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103718615
   00240 Pyrimidine metabolism
    103718615
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    103718615
Enzymes [BR:pda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     103718615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-GeneID: 103718615
NCBI-ProteinID: XP_026664882
UniProt: A0A2H3YYK6
Position
Unknown
AA seq 311 aa AA seqDB search
MDARAAAISKPIVLITNDDGIDAPGLRFLVDLLVATDRYRVLVCAPASDQSGVSHSVTWR
HPLSAKRVEIEGAAAFAVSGTPADSASLGISGKLFDGIIPDLVISGINIGCNCGYHVVYS
GTVAGAREAFLYGVPALAISHNWMGSKSTVNDLKLAAEVCLPVINAVLTDLRNKTYPEGS
FLNIDVPTDVAHHKGFKITKQGKAMVRIGWEQTNENTPSMESYQTANIDVDMKPISEKNA
SVPVENHLLFKRVLSKRKMEEDEAEDTDHKALQEGYITITPLGALSHAEADAMTYFKDWL
LHLADYSSSSL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggacgccagggcggccgcgatctcgaaaccgatcgtgctgatcaccaatgatgacggg
atcgatgcccccgggctgcgcttcctcgtcgacctcctcgtcgccaccgatcgctaccgt
gttcttgtttgcgcccccgcttcggaccagtcaggtgttagccatagcgtcacgtggcgt
catcctctcagtgccaaacgtgttgaaattgaaggtgctgcagcctttgcagtttcagga
actcctgcagattctgcttctttgggtatttctggaaagctctttgatggtataattcct
gatttggtaatcagcggcatcaacattggttgcaattgtggatatcatgtagtttactct
gggacagtagctggtgctcgggaggctttcttatatggtgtccctgctttagctatatca
cataattggatgggcagtaagagcactgtcaatgacctcaaacttgctgcagaggtttgc
ttgcctgtcataaatgctgtgttgactgacctcagaaataagacataccctgaaggttca
tttttgaatatagacgtgccaacagatgttgcacatcacaagggatttaagatcacaaaa
caggggaaggccatggtccggattgggtgggagcagacaaatgaaaacacaccaagcatg
gaaagctatcaaacagcaaatattgatgttgacatgaaaccaatctctgaaaagaatgcc
tcggttccagtagaaaatcatcttttgttcaagagagtgctttcaaagagaaagatggaa
gaggacgaagcagaggacacagaccataaagcccttcaagaaggatatattacaatcacc
cctctaggtgccctctctcatgcggaggctgatgccatgacctactttaaagattggctg
ctgcatttggctgattattcatcatcctccttataa

DBGET integrated database retrieval system