KEGG   Phoenix dactylifera (date palm): 103719868Help
Entry
103719868         CDS       T03274                                 

Definition
(RefSeq) cyclin-dependent kinase G-2
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pda01001]
    103719868
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pda03041]
    103719868
Enzymes [BR:pda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103719868
Protein kinases [BR:pda01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103719868
Spliceosome [BR:pda03041]
 Complex A
  Other components
   Complex A specific factors
    103719868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 103719868
NCBI-ProteinID: XP_008807532
UniProt: A0A2H3Z372
Position
Unknown
AA seq 721 aa AA seqDB search
MGASRHGGYRDQEFRDRESDVEVSRRKDYYLDRYRDGDRDRNHGRDIRDRVRDRQRDTKK
RDSLNGYHRSPLSISNSSGSGGNEQKRSRLSGRLVDREPGELSSGSGSDDREAPELQVRD
NGSQGKENGALPSPSRKRKFSPIVWDRDDNNQSTVVSSRNRNDPQAPAALAPPLPLPRGY
VPHNLLETVRQSMKQQSPVDARVSIDSPHDQQLSNDHDPGQMEDEDEEYHTARNISTSRW
ANGNNELDDDEAKLSDGAVVPKRKKNTPVVDTLDQKSHKKVLSPEPGEVVMREGSEGTAS
KSSVSGGDHRDEYHGVEVDRNDYMDIDMEAVDGDASGHLSETDSEIEGARAETPEPVQSP
QRCIDMLQGCRSVDEFERLNKIDEGTYGVVYRAKDKKTGEVVALKKVKMEKEREGFPLTS
LREINILLSFHHPSIVDVKEVVMGSLDSIFMVMEYMEHDLKGLMEAMKQPFSQSEVKCLM
LQLFEGVKYLHDNWVLHRDLKTSNLLLNNRGELKICDFGLARQYGSPLKPYTHLVVTLWY
RAPELLLGAKEYSTAIDMWSLGCIMAELLAKEPLFNGKTEFDQLDKIFRTLGTPNEKIWP
GFAKLPGVKVNFVKQPYNRLREKFPPTSFTGRPTLSEAGFDLLNKLLTYDPEKRITAEAA
LEHPWFSEVPLPKSKEFMPTFPAQHAQDRRLRRIMKSPDPLEEQRRKELQQGESGTGSIF
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgagtcggcacgggggctacagagaccaagaatttagggaccgggaatctgat
gtagaggtctccaggaggaaggattattatctggatcggtaccgtgatggggaccgggac
aggaaccatgggcgggatatccgggacagggttagggataggcagagggacaccaagaaa
agggattctttgaatgggtaccaccgttctcccttgagcattagcaattcgagtggtagc
ggtgggaacgagcagaagcggagccggctctcggggaggttggttgatcgggagcctggg
gagctgtcgagtggaagcggatccgatgaccgtgaggctcctgagttgcaggttagagat
aatggaagtcagggcaaggaaaatggggctctgccctcgccaagcagaaagaggaagttt
tcaccaattgtgtgggatagggatgataacaaccaatctactgttgtgagttccagaaac
agaaacgacccacaagcacctgccgctcttgctccacctcttccactgccccgcggatat
gtcccacataatttgcttgagacagttcggcagtccatgaagcagcagtcaccggtagat
gcgagggtctccattgattcaccccacgatcagcagttgagtaatgatcatgatcctggg
cagatggaggatgaggatgaggagtaccacacagcaaggaacatctccacttcacgatgg
gcaaatgggaacaatgagttggatgatgatgaagctaaattatctgatggcgcggttgtg
cccaagaggaagaaaaatacccctgtggttgatacactggaccagaaatcacataagaag
gtgctgagtcctgagcctggagaggttgttatgagagaaggttctgaagggacggcatcc
aaatcatctgtatctgggggagaccacagggatgagtatcatggagttgaggtagatagg
aatgattatatggatattgacatggaggcggttgatggggatgcatctggtcatttgtca
gagactgattctgagatagagggtgctagggctgaaaccccagaaccagtgcaatctccc
caaagatgtatagacatgctacaagggtgtagaagtgttgatgagtttgagaggctgaac
aagatcgacgaaggcacttatggagttgtgtacagagcaaaggataagaagactggtgaa
gtagtggcattgaagaaggtgaagatggagaaggagcgagagggcttcccgttgacctct
ttgagggaaattaacattttgctgtcgtttcaccacccttcaattgtggacgtcaaggaa
gttgttatgggcagccttgatagtattttcatggttatggagtacatggagcatgatctc
aaagggctgatggaggcaatgaagcagccatttagccagagcgaagttaagtgcttaatg
cttcagttgtttgaaggtgtcaagtatctccatgataactgggtacttcatagggatctg
aagacgtcaaatcttcttctgaataatcgtggcgagttgaaaatatgcgactttggtctg
gctcgccagtatgggagcccattgaagccatatactcatttggttgtgactttgtggtac
agggcaccagaacttctattaggagcaaaggaatattcaactgctattgacatgtggtca
ttgggttgcataatggctgaacttttagccaaggaaccattattcaatggaaaaactgag
tttgatcaacttgacaagatatttagaacactcggtacaccaaatgagaagatatggcct
gggtttgctaaattgcctggcgtgaaagttaactttgttaagcagccgtataataggctg
cgggagaagttcccacctacatcatttactggtcgtccaaccctatctgaagccggtttt
gacctgttgaacaaactactaacttatgacccagagaagcggataacagcagaagctgcc
cttgagcatccctggtttagtgaagttcctttaccaaagtcaaaggaatttatgccgaca
ttccctgctcaacatgcccaagacaggcggctgcgcagaattatgaaaagtcctgatccg
ttagaggagcaaaggaggaaggaattacagcaaggggaatcagggactggcagcattttt
ggttga

DBGET integrated database retrieval system