KEGG   Phoenix dactylifera (date palm): 103720286Help
Entry
103720286         CDS       T03274                                 

Definition
(RefSeq) phosphopantothenoylcysteine decarboxylase-like
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00770  Pantothenate and CoA biosynthesis
pda01100  Metabolic pathways
Module
pda_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    103720286
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     103720286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 103720286
NCBI-ProteinID: XP_008808139
UniProt: A0A2H3Z400
Position
Unknown
AA seq 207 aa AA seqDB search
MAKVESSSDNVMHDHEQPVKPRILLAASGSVAAIKFESLCRSFSEWAEVRAVSTKSSLHF
LDEASLPRGVTLYTDDDEWSSWKKIGDGVLHIELRKWADIMVIAPLSANTLAKIAGGLCD
NLLTCIVRAWDYSKPLYVAPAMNTFMWNNPLTKRHLEAIGELGITLIPSITKRLACGDYG
NGAMAEPSVIYTTVRLAYKPSPVNGSG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggtggagtcatcatcagataatgtgatgcatgaccatgagcagcctgttaag
ccacggattctcctggctgccagcggaagtgtagctgctataaaatttgagtctctttgc
cgtagtttttcggagtgggcagaagtcagagcagtatccacaaagtcatccttgcacttt
ttagatgaagcatcacttccaaggggtgtgactctttacacagatgatgatgaatggtct
agttggaagaaaatcggagatggagtgttgcacatcgaactacgaaaatgggcagatatt
atggtaattgctccattatcagcaaataccctagctaagattgcaggaggactttgtgac
aatctattaacatgcattgtgcgagcttgggattacagcaagcctctgtatgttgctcct
gccatgaacaccttcatgtggaacaaccccttaacgaagcgtcatttagaagcaatcggc
gaacttggtataactttgattccatccatcacgaagaggctggcttgtggagattatgga
aatggggcgatggctgaaccttccgtgatctatactacagtgaggcttgcttacaagcca
tcgccagtaaatggatctggttga

DBGET integrated database retrieval system