KEGG   Phoenix dactylifera (date palm): 103721120Help
Entry
103721120         CDS       T03274                                 

Definition
(RefSeq) uncharacterized protein At4g19900-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00601  Glycosphingolipid biosynthesis - lacto and neolacto series
pda00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103721120
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    103721120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pda01003]
    103721120
Enzymes [BR:pda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     103721120
Glycosyltransferases [BR:pda01003]
 Glycan extension
  P blood group
   103721120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 103721120
NCBI-ProteinID: XP_017701669
UniProt: A0A2H3ZZ71
Position
Unknown
AA seq 418 aa AA seqDB search
MLRPTQPLSYLVLILPTSIVALPLLIYFLACSGLGLGLLCRANHPAFAPLRDPSPKTPSF
AASLQSSHLSPGSGDGHHPHTQPNSSLPSRKPAGSERSRLFPSFLHPSARSRRFSARAAE
FLHGSRSNPLDSPCTPRFFMTWISSSEVFRPRELFAVESLFKSHENACLLIVSNAMDSPS
GEQLLRPFSERGFRLAAMSPDFPYLFKNTPAEPWFHRLLKGEVNPGNVPLGQNLSNLLRL
AILYKYGGVYIDADVIVLRSFHGLRNAIGAQSVNAETGNWSRLNNAVMAFDEEHPLLYKF
IEEFARTFNGSKWGHNGPYLVSRVVARVAERPGFEFRVLPPAAFYPVGWHKISTLFQAPR
NGKHWKWIAKKHDSIRRRSFALHLWNRESRNIEVEEGSIIGRIMSECCLLCNSSVNVM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggccaacgcagccgctttcttaccttgttctcatcctcccgacctccatcgtc
gccctccccctcctcatctacttcctcgcctgcagcggcctcggcctcggcctcctctgc
cgcgccaaccaccctgctttcgctcctcttcgcgaccccagcccaaagaccccttctttc
gccgcatccctccaaagttctcacctttcgccgggttccggcgatggacatcatccccat
acccagccgaactcctctctgccttccaggaagcccgcggggtcggaaaggagcaggctt
tttcccagcttccttcaccccagtgctcggtcgcgtcggttctccgcgcgagctgccgag
ttccttcacgggtctcgctctaatcccctggattctccttgcacgcctcgttttttcatg
acctggatctcctcctcggaagtttttcgccccagggagttgttcgcggtcgagagcttg
ttcaagtcccatgaaaacgcctgcttgctcattgtttccaacgccatggactcgccgagc
ggcgagcagctattgagacctttctccgagaggggcttccggttggcggccatgtcgccg
gacttcccctacctcttcaagaacacgcctgccgagccatggttccatcggctcttgaaa
ggggaagtcaatcccgggaatgtcccccttggccagaatctatccaacttgctccggctt
gcaatcttgtacaagtatggaggagtttacatcgacgccgacgtcatagttctgagaagc
ttccatggtctgaggaatgccattggagcccagtccgtcaacgccgagaccggtaactgg
agccggctgaacaacgccgtgatggcattcgatgaggagcatccacttctttataaattc
atagaggagttcgcgcggaccttcaatgggagcaagtggggtcacaacggaccttacctt
gtttcgagggtcgtcgccagggtcgccgagaggcctggctttgaattcagagtattgccg
ccggcggcattctatccggtgggttggcataagatatcgacgctgtttcaggcgcccaga
aatgggaagcattggaagtggattgcgaagaagcacgattccattcgtagacggagcttc
gccctgcatctttggaaccgggagagcaggaacattgaggttgaggaggggagcatcatt
gggagaataatgtcggagtgttgtttgctctgcaattcttcagtgaatgtaatgtaa

DBGET integrated database retrieval system