KEGG   Phoenix dactylifera (date palm): 103721452Help
Entry
103721452         CDS       T03274                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial isoform X1
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00250  Alanine, aspartate and glutamate metabolism
pda00650  Butanoate metabolism
pda01100  Metabolic pathways
Module
pda_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103721452
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103721452
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     103721452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103721452
NCBI-ProteinID: XP_008809896
UniProt: A0A2H3Z8X6
Position
Unknown
AA seq 519 aa AA seqDB search
MHRVALVARHVLTPSLFFRRQMSMEPGAAINRVRESGLLKTQGLIGGKWIDAYDGKTIEV
QNPATGDIVTSVAYMGKKETTDAISSAYNTFNSWSKHTASERSKCLRKWYDLMISHKEEL
ALLMTLEQGKPLKEALGEVAYGAGFIEFFAEEAKRIYGDIIPATLADRRLFVLKQPVGVV
GAITPWNFPLAMITRKVGPALACGCTVVVKPSEYTPLTALAAAELSLQAGIPPGVLNVVV
GNASDIGDTLLQSTKVRKITFTGSTAVGKKLLAGSANTVKRISLELGGNAPCIVFDDADL
DVAVKGALAAKFRNSGQTCVCANRILVQEGIYEKFANAFAKAVQNLQVGNGLVEGIAQGP
LINEAAVEKVEKFIKDATSKGANVILGGRRHSLGMTFYEPTVLGNVNDEMLVSREEVFGP
VAPLLRFKTEEDAIHIANDTNAGLAAYIFTTSIPRSWRVTEALEYGLVGVNEGLISTEVA
PFGGFKQSGLGREGSKYGIDEYLELKYVCLGNMKEAYTK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgtagctctcgtcgcccgccacgtcctaaccccctccctcttcttccgccgc
cagatgagcatggagcctggggcggcgatcaatcgggtgcgggagtcggggctgttaaag
actcagggacttatcggaggcaaatggattgatgcttatgatgggaaaaccatcgaggtg
caaaaccctgctactggggatattgtaacaagtgttgcatacatgggcaagaaggaaaca
actgatgcaatatcttcagcatacaacacatttaactcttggagtaaacatactgcaagt
gagaggagcaagtgtctaaggaaatggtatgatctaatgatttcccacaaggaagaactc
gcactacttatgactttggaacaagggaagcctctaaaagaggccttgggtgaggttgct
tatggtgctggctttattgaattttttgctgaggaggcaaaacgtatatatggtgacatt
attcctgctacactagctgatcgccgactatttgtattaaaacagcctgtaggagtagtt
ggcgcaattaccccatggaactttcctttagccatgattacacggaaggttggccctgca
ctagcttgtggctgcaccgttgttgttaaaccatccgagtatacacccttgactgcatta
gctgccgctgagctctctcttcaagctggaataccaccaggtgtgctgaatgtggtggtg
ggcaatgcttctgatattggggatactctactccaaagcaccaaggtaagaaagatcacg
ttcactggatcaacagctgttgggaagaaattgttagcaggttcagcaaatactgttaaa
aggatatctttggaacttggtggaaatgcaccctgcattgtctttgatgatgcagatctg
gatgttgcagtaaaaggcgctcttgcagcaaagtttcgtaacagtgggcaaacatgtgtt
tgtgcaaatagaattctggtgcaagaaggcatttatgaaaagtttgcaaatgcttttgca
aaggctgttcagaatttgcaggttggcaatggcctcgtagaaggcatagctcagggccca
ttaatcaatgaagctgctgtagaaaaggttgaaaaatttatcaaagatgccacttcaaag
ggagcaaacgttatacttgggggaaggagacacagtctgggcatgacattttatgagcct
actgtacttgggaatgttaatgatgaaatgctcgtatctagggaagaagtatttggtcca
gttgcaccgctcctgcgttttaaaacggaagaagatgctattcatatagctaatgacaca
aatgcagggcttgctgcttacatattcacaacaagcatacctcgttcttggcgtgtaact
gaagctcttgaatatggacttgttggtgtaaatgaaggactgatatctactgaggtggca
ccatttggaggatttaagcagtctggtcttggacgagaaggttcaaaatatgggatagat
gagtatttggaacttaaatatgtctgtttggggaacatgaaggaggcttatacaaaatga

DBGET integrated database retrieval system