KEGG   Phoenix dactylifera (date palm): 103721826Help
Entry
103721826         CDS       T03274                                 

Definition
(RefSeq) inorganic pyrophosphatase 2-like
  KO
K13248  pyridoxal phosphate phosphatase PHOSPHO2 [EC:3.1.3.74]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00750  Vitamin B6 metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    103721826
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pda01009]
    103721826
Enzymes [BR:pda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.74  pyridoxal phosphatase
     103721826
Protein phosphatases and associated proteins [BR:pda01009]
 HAD phosphatases
  Other HAD phosphatases
   103721826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Put_Phosphatase HAD
Motif
Other DBs
NCBI-GeneID: 103721826
NCBI-ProteinID: XP_008810403
UniProt: A0A2H3Z9D9
Position
Unknown
AA seq 188 aa AA seqDB search
MARIVVVFDFDKTIIDCDSDNWVVDQLGATELFEHLLPTMPWNSLMDRMMKELHLQGKTI
EEISDCLKRAPLDPRIITAVKSAYDLGCDLRVVSDANLFFVVTVLKHHGLLEYFSEINTN
PSYMDEEGRLRIFPYHDFTTSSHGCSLCPPNMCKVTIFLRKPSLLNYLFSVMYSASSSHN
FINGSKNL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggatcgtcgtggtgttcgacttcgacaagacgatcatcgactgcgacagcgat
aactgggtcgtcgaccagctcggcgccaccgagctttttgagcacctcctcccgaccatg
ccgtggaattctctcatggacaggatgatgaaggagctacatttacaggggaagaccatc
gaagaaatttcagattgcctgaagagggctccgttggaccctcgcatcatcacggccgtc
aaatcggcttatgatcttgggtgtgatctgagggtggtgagtgatgccaacctcttcttc
gtcgtgacagtcctcaaacaccatgggcttcttgagtatttctcggagatcaataccaat
ccaagctatatggacgaggaggggaggctcaggatcttcccttaccatgacttcaccacc
tcttctcatggctgcagcctctgccctccaaacatgtgcaaggtaactattttcttaaga
aaaccttctttgcttaattatttattcagtgtgatgtatagtgcctcttcaagccataac
ttcattaatggttctaaaaatctataa

DBGET integrated database retrieval system