KEGG   Phoenix dactylifera (date palm): 103722148Help
Entry
103722148         CDS       T03274                                 

Definition
(RefSeq) tryptophan decarboxylase 2 isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00350  Tyrosine metabolism
pda00360  Phenylalanine metabolism
pda00380  Tryptophan metabolism
pda00950  Isoquinoline alkaloid biosynthesis
pda00965  Betalain biosynthesis
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103722148
   00360 Phenylalanine metabolism
    103722148
   00380 Tryptophan metabolism
    103722148
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103722148
   00950 Isoquinoline alkaloid biosynthesis
    103722148
   00965 Betalain biosynthesis
    103722148
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pda04147]
    103722148
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103722148
    4.1.1.105  L-tryptophan decarboxylase
     103722148
Exosome [BR:pda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103722148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103722148
NCBI-ProteinID: XP_008810816
UniProt: A0A2H3ZA91
Position
Unknown
AA seq 487 aa AA seqDB search
MENTLKPMDAEQLREYGHKMVDFIADYYKSIESFPVLSQVKPGYLKELLPDSAPNHPESL
QDVFEDIRQKIIPGITHWQSPEYFAYYPSNSSTAGFLGEMLSAGFNIVGFSWVTSPAATE
LEVIVLDWLAKMLKLPDQFFSAGQGGGVIQGTASEAVLVVLLAARDKILRKVGKKSLEKL
VVYASDQTHSALQKACQIAGIVQDNFRVLKADRNSNYSLCPEVALEAISNDLSAGLIPFF
LCATVGTTSSAAVDPLSELGKLSKAYGMWFHVDAAYAGSACICPEYRHYIDGVEEADSFG
MNAHKWFLTNFDCSLLWVKDQRPLVQSLSTNPEFLKNKASQENAVVDFKDWQIPLGRRFR
SLKLWMVLRLYGLENLQSYIRNHINLAEQFEQLIKTDSRFEVVSPRNFSLVCFRLLPAFD
DHDNGYKLNYNLLDAVNASGKIFISHTVLSGNFVLRFAVGAPLTEEKHIKEAWKVLQDHA
TTLLRSI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagaatactttgaagccaatggacgcggagcagctgagggagtacggccataagatg
gttgatttcatcgccgattactacaaaagcatcgagtcctttccggttctcagccaagtc
aagcctggatatcttaaggagcttctgccagattcagctcctaatcatcctgaaagtttg
caagatgtctttgaggatatccgtcagaagataataccaggcataacccattggcagagc
cctgaatattttgcctactatccctctaatagcagcacagctggattcttaggagagatg
ctcagtgctggttttaatattgtgggtttcagttgggtcacctctccagctgcaacagaa
cttgaagtgattgttttagattggctcgctaaaatgctgaagctgcctgaccagttcttt
tcagcagggcagggtgggggagtaatccaaggtacagctagtgaagcagttcttgttgtc
ttgttggctgcccgtgataaaattttgaggaaggttgggaaaaagtctcttgaaaaattg
gtagtttatgcttctgatcaaacacactctgctctgcaaaaggcatgccagattgcaggg
attgttcaggacaactttagagtgctgaaggctgatagaaattcaaactattctctttgt
cctgaagtagctttggaagcaatctctaatgacttatcagcaggcttgataccatttttc
ctttgtgctacagttggcactacgtcttcagcggctgtggatcctttgtctgagttaggt
aagttatccaaggcctatggcatgtggttccatgttgatgctgcatatgctggcagtgca
tgtatttgtccagagtaccgtcattatattgatggtgtggaagaagcagattcatttggc
atgaatgcacacaaatggtttcttacaaattttgactgttcattgctctgggtaaaggac
caacgaccattggttcaatcactgtcgactaatcctgagtttctgaaaaacaaggcctcc
caagaaaatgctgttgtggatttcaaagattggcaaattcctcttggacgccgtttcaga
tcattaaagctgtggatggttttgaggctatatggtttggagaacctacaaagctacatt
aggaatcacataaatctggccgaacaatttgaacaactaatcaaaactgattctcggttt
gaggttgtgtcccctcgaaacttttcgcttgtctgtttccgtctgctccctgcatttgat
gatcatgacaatggttataaactgaactacaacttactagatgctgtcaatgcaagtgga
aaaatcttcatatcacatactgttctatcaggcaattttgtattgcgttttgctgtggga
gcaccactaacagaagagaaacatatcaaggaagcttggaaggtgttacaggaccatgcc
acgacccttttaaggagcatttag

DBGET integrated database retrieval system