KEGG   Phoenix dactylifera (date palm): 103723103Help
Entry
103723103         CDS       T03274                                 

Definition
(RefSeq) probable protein S-acyltransferase 7
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
pda  Phoenix dactylifera (date palm)
Brite
Enzymes [BR:pda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103723103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC UPF0542
Motif
Other DBs
NCBI-GeneID: 103723103
NCBI-ProteinID: XP_008812135
UniProt: A0A2H3ZDE7
Position
Unknown
AA seq 427 aa AA seqDB search
MQGKMYGTAAPQLSDSNRRIIETNGPSKRVYQVWKGSNRFFLGGRLIFGPDARSLILTLL
LIVIPVILFGAFVSPKLVNEFQHQFGNLIIAIVIIFTVHTLFLLLLTSGRDPGIMPRNAH
PPEPEDVGEASNSSVDWPGSQHGNPSLPPTKDVLVNGFTVKVKYCHTCMLYRPPRCSHCS
ICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSATFLCLYVLAFCWVNLKKIMEAYECN
LWKALLKSPVSGILILYTFVVVWFVGGLTAFHLYLICTNQTTYENFRYRYDKKNNPYNRG
WVQNIREIFFSRIPSSKNDFRAKVKEDSIAFTSSRSMGRPLSPDMPKTSLDLEMGGKRQN
VAAEELEDLQNQIGSISGLERCGTEPPYSSRGGYKGEITPDLEALAAEFGMQHGFTEREK
KSGQSLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaaagatgtatgggactgcagctcctcagctctccgattcaaataggaggatt
attgaaacaaatggtccatcaaagcgggtgtatcaagtctggaaaggaagcaatagattc
tttcttggagggaggcttatttttgggccagatgcaaggtcactgatattaactctactt
ctaatagtaattccagtaatcctgtttggggcatttgtttcaccaaaactggttaatgag
ttccaacaccaatttgggaatctgatcattgctatagtcattatcttcactgttcatact
ctctttcttcttcttctcacatctggtagagatcccggaattatgcctcgtaatgcacat
ccaccagagccagaagatgttggtgaagcttccaattcatctgtagattggccagggagt
cagcatggtaacccaagtttgcctcctaccaaggatgtccttgtcaatggatttacagtc
aaggttaaatactgccatacatgcatgctgtatcggccgccaagatgttctcattgctct
atatgtaacaactgtgtggaacgttttgatcatcattgtccttgggttgggcaatgcatt
gggaagaggaattaccgcttcttttttatgtttgtgtcctccgcaaccttcctatgtctg
tatgttcttgctttttgctgggttaacctcaagaagattatggaagcgtatgaatgcaat
ctatggaaagctcttctgaaatcacctgtctctggcattctaatcttatatacatttgta
gtggtttggtttgtaggagggttaacagccttccacctctatctaatttgcaccaatcag
acaacttatgaaaatttccggtaccgctatgataagaagaataatccttacaatcgtggt
tgggttcaaaatattagggaaatcttcttctcaagaatccctagctccaagaatgacttc
cgagctaaggtgaaggaggactcaattgccttcacctcttcacgctccatgggacgtccc
ttaagcccagatatgcctaagacaagcttggacctagaaatgggtgggaaacggcagaat
gtggcggcagaggaattggaagatttacagaaccagattggaagtatatcagggttagag
agatgtggcactgaacctccgtactccagccggggtggctacaagggggaaataacacct
gatttagaggcattggcagctgagtttggcatgcagcatggatttaccgaaagagaaaaa
aaatctgggcagtctttgaaatga

DBGET integrated database retrieval system