KEGG   Phoenix dactylifera (date palm): 103723655Help
Entry
103723655         CDS       T03274                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00350  Tyrosine metabolism
pda00360  Phenylalanine metabolism
pda00380  Tryptophan metabolism
pda00950  Isoquinoline alkaloid biosynthesis
pda00965  Betalain biosynthesis
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103723655
   00360 Phenylalanine metabolism
    103723655
   00380 Tryptophan metabolism
    103723655
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103723655
   00950 Isoquinoline alkaloid biosynthesis
    103723655
   00965 Betalain biosynthesis
    103723655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pda04147]
    103723655
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103723655
    4.1.1.105  L-tryptophan decarboxylase
     103723655
Exosome [BR:pda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103723655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103723655
NCBI-ProteinID: XP_008812851
UniProt: A0A2H3ZF69
Position
Unknown
AA seq 490 aa AA seqDB search
MGSLPLDTFQLLDPDVLANESRVVVDFIADYYRDIEQLPVRSQVEPGYLGKRLPDSAPYL
PQSIDAILEDIREDIIPGLTHWQSPNFYAYFQANASTAGFLGEMLCSGLNVVGFNWISSP
AATELEGIVMDWMGKMLKLPSSFLFSCGQGGGGVLHGSTCEAVVCTLAAARDKALSKIGA
DGITKLVVYASDQTHFTVQKASKLVGIPPSNFRAIPTTAASGYALTPDSVRSAMEADIAK
GLVPLYLCATVGTTAVGAVDPLLELGKVANKYGVWYHIDAAYAGSSGICPEFRHYFDGVE
LAHSISMNPHKWFLTNMDCCCLWLKSPSALVDSLSTSPEILRNKASDAKIVVDYKDWQIA
LSRRFRAMKLWVVIRRYGVANLMEHIRSDVAMAKHFERLVAMDQRFEVVVPRKFSLVCFR
LKPRFEGDDASDLNRRLLEAVNLSGRAFMTHAVVGGTYMIRFAIGTTLTEMRHVQATWKL
IQSKADEIIV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtctcccgcttgacaccttccagctcctagatcctgatgtccttgccaatgag
tctcgtgttgtggtcgactttatagccgactactatcgagacatcgagcaattaccggtt
cgaagccaggtagagccggggtatcttggcaagcgtctccctgattcagctccttatctc
ccccagtccattgatgccatcctcgaagatatccgcgaggatatcatccccggtctaact
cattggcagagcccgaacttttatgcctactttcaagccaacgcgagcactgctgggttt
ctcggtgagatgctttgctctggcctgaacgttgtggggttcaattggatctcatcacca
gctgccaccgagcttgaaggtattgttatggattggatggggaagatgctcaagctccca
tcttcatttttattctcgtgtggtcaaggtggcggtggtgttttgcatggcagcacatgc
gaggccgtggtgtgtacgctagcagcagcacgcgacaaggccttgagcaagatcggggcg
gatggtatcacaaaattggtggtgtatgcctctgatcaaacacacttcaccgttcagaag
gcgtccaaactcgtcggcatcccaccatccaacttcagggcaatcccgactacagctgca
tcaggctatgcactgactcctgatagtgttcggtccgccatggaggccgacattgccaaa
gggttggtgcccttgtacctgtgtgccacggtcggtaccaccgctgtgggagccgtggat
ccgttgctagagctcggcaaagttgcaaacaaatatggtgtttggtatcatattgatgca
gcttatgctggcagttcgggtatatgccctgaattccggcattactttgatggtgtggag
cttgcccactcgatcagcatgaatccccataagtggttcctcaccaacatggactgctgc
tgcctatggcttaagagcccttcggcactggtggattctctatctaccagtcctgaaata
ttaaggaacaaagccagtgatgccaagattgtggtggactacaaggactggcagattgca
ctgagccggcgcttccgagccatgaagctgtgggtggtcatccggaggtatggcgtggcg
aacctaatggagcacatacggagtgacgtcgcaatggctaagcacttcgagaggctggta
gcgatggaccagaggttcgaggtggtggtgcctcggaaattctccttggtgtgctttcga
ctaaagccaaggttcgaaggagatgatgcttcggacctgaaccgaaggctccttgaggca
gtgaacttaagtggacgagctttcatgacgcatgcagtggtgggcggcacgtacatgata
cgttttgcaattggaaccaccctaacggagatgcggcatgttcaggctacatggaagctc
attcaatccaaagccgatgaaataatagtctag

DBGET integrated database retrieval system