KEGG   Pasteurella dagmatis: 4362423_01687Help
Entry
4362423_01687     CDS       T05467                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pdag  Pasteurella dagmatis
Pathway
pdag00020  Citrate cycle (TCA cycle)
pdag00480  Glutathione metabolism
pdag01100  Metabolic pathways
pdag01110  Biosynthesis of secondary metabolites
pdag01120  Microbial metabolism in diverse environments
pdag01130  Biosynthesis of antibiotics
pdag01200  Carbon metabolism
pdag01210  2-Oxocarboxylic acid metabolism
pdag01230  Biosynthesis of amino acids
Module
pdag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdag_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pdag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4362423_01687 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4362423_01687 (icd)
Enzymes [BR:pdag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     4362423_01687 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: SNV79892
Position
1:complement(1807433..1808680)
Genome map
AA seq 415 aa AA seqDB search
MQSKVVIPQGEKIQLDAKGAFIVPNNPIIPFIEGDGIGIDVTPAMRTVIDAAVEKAYGGK
RKISWMEIYAGGKANEVYGENTWLPDETMEFIRDYHVAIKGPLMTPVGGGIRSLNVAMRQ
GLDLYNCLRPIRYYEGTPSPVKHPELVDMVIFRENSEDIYAGVEWVAGSAEANKVIEFLQ
KEMGVKKIRFTEDCGIGIKPVSKQGTQRLVRAALQYVIDNDRKSLTLVHKGNIMKFTEGA
FKEWGYEVAKEFGAELLDGGPWMKLKNPKSGKEIIIKDSIADAFLQEILLHPTEYDVIAT
LNLNGDYISDALAAQVGGIGISPGANIGSEAAIFEATHGTAPKIAGQDKGNPGSLILSGE
MMLRHLGWLEAADLVVKAVSKTIADKTVTFDFAEMLEGAKLRSTSEFAKDIVANM
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaaaagttgttatcccacaaggtgaaaaaattcaactggatgcaaaaggcgca
ttcattgtgcctaataatccaattattccatttattgaaggcgatggtatcggtatagat
gtaacgcctgcgatgcgtactgtcattgatgcagcagtggaaaaagcctatgggggcaag
cgtaaaatttcgtggatggaaatttatgcgggcggcaaagcgaatgaagtatatggtgaa
aatacttggttgccagatgaaacaatggaatttattcgtgattatcacgtggctatcaaa
gggcctttaatgacccctgtcggtggtggcattcgttcacttaacgtggcaatgcgtcaa
ggattagatttatataactgtttacgtccaattcgttattatgaagggacaccaagccca
gtgaaacaccctgaacttgtggatatggtgattttccgtgaaaactccgaagatatttat
gcaggcgtagaatgggtagcgggctccgcagaagcgaacaaagtaattgagtttttacaa
aaagaaatgggcgtgaagaaaatccgtttcactgaagattgtggcattggtattaaacca
gtttcaaaacaaggcacccaacgtttagtgcgtgctgcattgcaatatgtgatcgacaat
gaccgcaaatcgctcactctcgtgcacaaaggtaacattatgaaatttaccgaaggggca
tttaaagagtggggttatgaagtcgcgaaagaatttggtgctgaattgctggatggcggt
ccttggatgaaattaaaaaatccaaaatcaggcaaagagatcattattaaagacagcatt
gcagatgccttcttgcaagaaattctgcttcacccaacggaatatgatgttattgcaaca
ttgaatttaaacggtgactatatctctgatgcgttagcggctcaagtgggtggtattggg
atttctccgggggcaaatattggatcagaagcggcaatttttgaagccactcatgggact
gcaccgaaaattgcgggtcaagataaaggcaatccaggctcattgattttaagtggtgaa
atgatgttacgccatttaggctggttagaggctgctgatttagtggtaaaagcagtatcg
aaaaccattgcagataaaactgtaacatttgattttgcagaaatgttagaaggtgcaaag
ttacgttcaacttctgaatttgcgaaagatattgtggcaaatatgtaa

DBGET integrated database retrieval system