KEGG   Pasteurella dagmatis: 4362423_01728Help
Entry
4362423_01728     CDS       T05467                                 

Gene name
yrfG
Definition
(GenBank) protein YrfG
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
pdag  Pasteurella dagmatis
Pathway
pdag00230  Purine metabolism
pdag00240  Pyrimidine metabolism
pdag00760  Nicotinate and nicotinamide metabolism
pdag01100  Metabolic pathways
pdag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdag00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4362423_01728 (yrfG)
   00240 Pyrimidine metabolism
    4362423_01728 (yrfG)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4362423_01728 (yrfG)
Enzymes [BR:pdag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     4362423_01728 (yrfG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase NIF Put_Phosphatase HAD
Motif
Other DBs
NCBI-ProteinID: SNV80491
Position
1:complement(1853311..1853967)
Genome map
AA seq 218 aa AA seqDB search
MKQLNWQNIDTVILDLDGTLIDLYFDHVFWKKIVPQVYADKFHISLKESTNLLKQRYEAI
EHTKDWYCLDFWAKTLDLPLHQMYQQHAPQVKVRSDVVPFLQTLNNMKKYVILLTDSNHF
CLETKLKYCDFTPYFDLLLSSHQFDAPKMEQVLWQRLQQKHYFKPERTLFVDDTENVLDS
ARQFGIAYTLGVENPDSSLPDKQFERHSSVKNYRTLIE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacttaattggcagaatatcgataccgttattttagatctagatggtacatta
attgacctttattttgatcatgttttttggaaaaaaattgtgccacaagtttatgctgac
aaatttcatatttctttaaaagaaagtacgaatttgctcaaacaacgttatgaagccatt
gagcatactaaagattggtactgtttagatttttgggcaaaaactttggatttaccctta
catcagatgtatcaacagcacgcacctcaagtaaaagtgcggtcagatgttgtgccattt
ttacaaactctcaataacatgaaaaagtacgtgattttactcactgatagtaatcacttt
tgtttagagaccaaattaaaatattgtgattttacaccctactttgatctactgttatca
agtcatcagtttgatgccccaaaaatggagcaagttttatggcaacgcttacaacaaaaa
cactattttaaacccgagcgtaccttatttgttgatgatacagaaaacgtactggacagt
gcacggcaatttggtattgcttatactttaggtgtagaaaatccagatagttcattgcca
gataagcaatttgaacggcactcttccgtaaaaaactatcgtactttgattgaatga

DBGET integrated database retrieval system