KEGG   Pasteurella dagmatis: 4362423_01732Help
Entry
4362423_01732     CDS       T05467                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pdag  Pasteurella dagmatis
Pathway
pdag00030  Pentose phosphate pathway
pdag00480  Glutathione metabolism
pdag01100  Metabolic pathways
pdag01110  Biosynthesis of secondary metabolites
pdag01120  Microbial metabolism in diverse environments
pdag01200  Carbon metabolism
Module
pdag_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pdag_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pdag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4362423_01732 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4362423_01732 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdag04147]
    4362423_01732 (zwf)
Enzymes [BR:pdag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     4362423_01732 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     4362423_01732 (zwf)
Exosome [BR:pdag04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4362423_01732 (zwf)
  Exosomal proteins of colorectal cancer cells
   4362423_01732 (zwf)
  Exosomal proteins of bladder cancer cells
   4362423_01732 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N DUF4346
Motif
Other DBs
NCBI-ProteinID: SNV80546
Position
1:1857863..1859353
Genome map
AA seq 496 aa AA seqDB search
MKIEADNNCIVIFGASGDLTHRKLIPALYNLYKIGRLTEHFSVLGVARTELSDESFRDKM
RQALIKHEGANGETLEEFCNHLYYQALNTSDASDYGKLIPRLDELHDKYQTYGNTLYYLS
TPPSLYGVIPECLAAHGLNTEEFGWKRLIVEKPFGYDIRTAKELDIQIHRFFAEHQIYRI
DHYLGKETVQNLLVLRFSNGLFEPLWNRNFIDYVEITGAESLGVEERGGYYDGSGAMRDM
FQNHLLQVLAMVAMEPPAIINADSMRDEVAKVLYCLHPLSQDDLENNLVLGQYGTGVING
EEVKGYLQEKGVPADSDTETYMALRCEIDNWRWAGVPFYVRTGKRLPTRVTEVVIHFKTT
PHPVFSQKAPENKLIIRIQPDEGISMRFGLKKPGAGFEAKEVSMDFRYADLASPSLLTAY
ERLLLDSMKGDATLFARTDAVHACWKFVEPILDYKAKNGRVYEYESGSWGPTEADKLIAK
TGRVWRRPSGLMKKKV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagaagcagataataattgtattgtgatttttggtgcttcaggagacttaact
catcgtaagttaattcctgcactttataatctttataaaataggccgtttaactgaacat
ttttcagtattaggtgtagcacgtacagaattaagtgatgaaagtttccgtgacaaaatg
cgccaagcattaattaagcacgagggtgccaatggtgaaactttagaagaattttgtaac
catttatattaccaagctttaaatacctcagatgcaagtgattatggcaaattaattcct
cgccttgatgaactgcacgataaatatcaaacctatggtaacactctctattacctttct
acaccaccaagcctttatggtgtgatccctgaatgtctagctgcacatggcctaaatacc
gaagaatttggttggaaacgtttaattgttgaaaaaccattcggctatgatattcgcact
gcaaaagaattagatattcaaattcaccgtttctttgcagaacaccaaatttatcgtatc
gaccattatttaggtaaagaaaccgtacaaaacctactcgttttacgtttctcaaacggt
ttatttgaacctctttggaaccgaaatttcatcgattatgttgaaattacaggtgcagaa
tccttaggtgttgaagaacgtggtggttattatgacggttcaggtgcgatgcgtgatatg
ttccaaaaccacttattgcaagtgcttgcaatggttgcaatggaaccacctgcaatcatc
aatgcagattcaatgcgtgatgaagtggcaaaagtgctctattgcttacacccattaagc
caagatgatttagaaaataacttagtgctcggacaatacggtactggtgtgatcaatggt
gaagaggtcaaaggttacttacaagaaaaaggcgtgccagcggactcagatacagaaacc
tatatggcattacgttgtgaaattgacaactggcgttgggcgggagtgcctttctatgta
cgtactggtaaacgtttaccgactcgagtgactgaagttgtgattcacttcaaaaccacg
ccacacccagtattcagccaaaaagcacctgaaaataaactgattatccgtattcagcca
gatgaaggcatttcaatgcgtttcggcttgaaaaaaccgggggcaggctttgaggctaaa
gaagtgtcaatggatttccgttatgctgatcttgcatcaccaagtttattaaccgcttat
gagcgcttacttttagattcaatgaaaggtgatgcaacgctatttgcgcgtactgatgcg
gtacacgcctgctggaaatttgttgagccaattttagattacaaagcgaaaaatggcaga
gtatatgaatatgaatcaggctcttggggaccaacagaagcggataaattgatcgcaaaa
acaggccgtgtgtggcgcagacctagcggtttaatgaagaaaaaagtgtaa

DBGET integrated database retrieval system