KEGG   Pasteurella dagmatis: 4362423_01742Help
Entry
4362423_01742     CDS       T05467                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pdag  Pasteurella dagmatis
Pathway
pdag00620  Pyruvate metabolism
pdag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4362423_01742 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdag02000]
    4362423_01742 (oadA)
Enzymes [BR:pdag01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     4362423_01742 (oadA)
Transporters [BR:pdag02000]
 Other transporters
  Primary active transporters [TC:3]
   4362423_01742 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 Amidohydro_1 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: SNV80700
Position
1:1868429..1870240
Genome map
AA seq 603 aa AA seqDB search
MTTQTKKIAITDVVLRDAHQSLFATRLRLDDMLPIANELDQIGYWSLEAWGGATFDACIR
FLGEDPWVRLRELKQAIPNTPLQMLLRGQNLLGYRHYADDVVDRFVERSVKNGMSVFRVF
DAMNDPRNMKQALQAVKRNGGHAQGTLSYTTSPAHNLQTWLDTTEQLLEIGVDSVVIKDM
SGILTPAEAYKLVSEIKKRYDVQLHLHCHATTGMAEMALLKAVEAGVDGIDTSISSMSGT
YGHPATEALVATLQGTQFDTGLDINKLERISAYFRNVRKKYAKFEGQLRGSDSRILVAQV
PGGMLTNLESQLKQQNASDKLDEVLKEIPRVREDLGFIPLVTPTSQIVGTQAVINVLMGE
RYKTIAKETAGILKGEYGRTPAPVNAELQAKVLDGGQPITDRPADHIAPEMDKLAAEIKQ
QAKEKGVKLAENEIDDVLIVALFPQIGWKFLENRGNPDAFEPAPTLEPAKTTEKPTAPVA
KAPVSGPSVYTVELEGKAFVVKVSEGGEISDIAPTSAPQAAPQPQAVPKPAAAGTPVSAP
MSGNIWKVVATEGQKVAEGDVLLILEAMKMETEIRANQAGTVQGICVKAGDTVSVGDTLM
TLA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgactactcaaactaaaaaaattgctattactgatgtcgttttacgtgatgctcatcaa
tctttatttgcaacacgtttgcgtcttgatgatatgttgccaattgcaaatgaacttgat
caaattgggtattggtccttagaggcttggggaggggcaactttcgatgcttgcattcgt
ttcttaggtgaagatccttgggtacgtttacgagaattaaaacaagcaataccaaacaca
ccattgcaaatgttattacgtggtcagaatttattaggctatcgtcattatgcagatgat
gtggttgaccgtttcgttgagcgctcagtgaaaaatgggatgtcagtattccgtgtattt
gatgcaatgaacgacccacgcaatatgaaacaagcacttcaagcagttaaacgcaatggt
ggtcacgcacaaggtacattaagttacaccaccagcccagcacacaacctacaaacttgg
ttagatacaactgaacagcttcttgaaattggcgtagattctgtggtgattaaagatatg
tccggtatcttaaccccagctgaagcttataaattagtaagtgaaatcaaaaaacgctat
gacgtgcaattacacttacactgccacgcaacaacaggtatggcagaaatggcattgtta
aaagcagtggaagctggcgttgatggtatcgatacttctatttcttcaatgagtggtact
tatggccaccctgcaactgaagctttagttgcaacgttacaaggtactcaattcgacaca
ggcttagatattaataaattagaacgtatctctgcttacttccgtaacgtacgtaaaaaa
tatgcgaaatttgaaggtcaattacgtggttcagacagccgtattcttgtagcacaagtg
ccaggcggtatgttgactaaccttgaaagccaattaaaacaacaaaatgcatcagacaaa
ttagatgaagtattaaaagaaattcctcgtgtacgtgaagacttaggtttcattccatta
gtaacaccaacttcacaaatcgtaggtactcaagcagtaattaacgtattaatgggcgaa
cgttataaaacgattgcaaaagaaactgcaggtattttaaaaggggaatatggtcgtaca
ccagcaccagtaaatgctgagttacaggcaaaagtgttagatggagggcaaccaattact
gaccgcccagctgatcacattgcaccagagatggacaaattagcagctgaaattaaacaa
caagcgaaagaaaaaggcgtaaaacttgccgaaaatgaaattgacgatgtgttaatcgtg
gcactcttcccgcaaattggttggaaattccttgaaaaccgtggcaatccagatgctttc
gaacctgcgccaacattagaaccggcgaaaactacagaaaaaccgaccgcacctgtagcg
aaagcaccagtatcaggtccttctgtttatactgttgagcttgaaggtaaagcattcgta
gtgaaagttagcgaaggtggtgaaattagtgatatcgcaccaacgtcagcaccgcaagca
gcgcctcaaccacaagctgtgccaaaaccagcagcggcaggtacaccagtgagtgcacca
atgtcaggtaacatttggaaagttgttgcaactgaaggtcaaaaagtggctgaaggtgat
gtattgctaattcttgaagcaatgaaaatggaaactgaaatccgtgcaaaccaagcaggt
acggtacaaggtatttgtgtgaaagcaggtgatactgtttctgttggcgataccttaatg
acattggcataa

DBGET integrated database retrieval system