KEGG   Pasteurella dagmatis: 4362423_01775Help
Entry
4362423_01775     CDS       T05467                                 

Gene name
adhE_2
Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pdag  Pasteurella dagmatis
Pathway
pdag00010  Glycolysis / Gluconeogenesis
pdag00071  Fatty acid degradation
pdag00350  Tyrosine metabolism
pdag00620  Pyruvate metabolism
pdag00625  Chloroalkane and chloroalkene degradation
pdag00626  Naphthalene degradation
pdag00650  Butanoate metabolism
pdag01100  Metabolic pathways
pdag01110  Biosynthesis of secondary metabolites
pdag01120  Microbial metabolism in diverse environments
pdag01130  Biosynthesis of antibiotics
pdag01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pdag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4362423_01775 (adhE_2)
   00620 Pyruvate metabolism
    4362423_01775 (adhE_2)
   00650 Butanoate metabolism
    4362423_01775 (adhE_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4362423_01775 (adhE_2)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4362423_01775 (adhE_2)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    4362423_01775 (adhE_2)
   00626 Naphthalene degradation
    4362423_01775 (adhE_2)
Enzymes [BR:pdag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4362423_01775 (adhE_2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     4362423_01775 (adhE_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: SNV81188
Position
1:complement(1911018..1913642)
Genome map
AA seq 874 aa AA seqDB search
MSHTAENNISPAQAEVNALVEKGLVALEEFRQLDQQQVDYIVAKASVAALDQHGVLAMHA
YEETGRGVFEDKATKNLFACEYVVNNMRNLKTVGVISEDDVTGITEIADPVGVVCGITPT
TNPTSTAIFKALISLKTRNPIVFAFHPSAQQCSAHAARVVYEAAVAAGAPKNCIQWIENP
SMEGTAALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKTADIKQATHD
IVMSKAFDNGMICASEQAAIVDQEVYDEFVAEMKSYGVYFVTKKEKAMLEEFIFGVKANS
ANCGGAKLNANVVGKPATWIAEQAGFKVPEKTNILAAECKEVGEKEPLTREKLSPVLAIL
KSTSTENGFELSEAMVNFHGLGHSAAIHTKDAAIAKAYGDRVKAIRVIWNSPSTFGGIGD
VYNSFLPSLTLGCGSYGKNSVGNNVSAVNLLNIKRVGRRRNNMQWFKVPSKIYFERDSIQ
YLQSMKGMERVVIVTDRTMVDLGFVEKIAKQITARGNHVTYQLFADVEPDPSIETVRRGA
ELIRNYQPDTIIALGGGSAMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGRK
ARFVGIPTTSGTGSEVTPFAVITEGDKKYPIADYSLTPTVAIVDPAFVMSVPAHVAADTG
LDVLTHATEAYVSVLANDFTDGLALQAIKLVFEHLERSVKEKDPESREKMHNASTMAGMA
FANAFLGMNHSLAHKIGGRFHTPHGRTNAVLMPHVIRYNGTRPQKTATWPKYNYYKADVK
YQDIARMLGLPCSTPEEGVKSFAKACYDLAVRVGIKMSFKEQGIDEKEWMDARRQIALLA
FEDQCSPANPRLPVVADMEVILTNAYNGYEEGLY
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatactgctgaaaataatatcagtcctgcacaagcggaagtgaatgcactagtt
gaaaagggattagtagcattagaggaatttcgtcaactcgatcaacaacaagtagattat
atcgttgcgaaagcctctgttgctgcgctagatcaacacggtgtgttagcaatgcacgct
tatgaagaaacaggtcgtggtgtgtttgaagacaaagcaacgaaaaacctgtttgcgtgt
gaatatgtcgtcaataatatgcgcaatctgaagacagtaggcgtaatcagtgaagatgat
gtcactggtatcactgaaattgctgatcctgtcggtgttgtttgcggtataacaccaacg
actaacccaacttccactgccattttcaaagccctcatttctctcaaaactcgtaaccca
atcgtctttgcttttcacccttctgcacaacaatgttctgctcatgctgctcgtgttgtt
tatgaggcggctgttgcggctggtgcgccaaaaaactgtatccaatggattgaaaaccca
tcaatggaaggcactgctgcattaatgaaacacccaggtattgcaacgattcttgcaaca
ggtggtaatgcaatggtagaagcagcctattcttgtggaaaacctgcattaggtgtaggg
gcgggtaatgtgcctgcatacgttgaaaaaacggctgatatcaaacaagcaacgcatgat
attgtgatgtcaaaagcttttgataacgggatgatttgtgcgtctgaacaagctgcaatt
gttgatcaggaagtgtacgatgaatttgtggcagaaatgaaatcttacggtgtttacttt
gttactaaaaaagaaaaagcgatgttagaagaattcatttttggcgtaaaagcgaatagt
gcaaactgcggtggtgcaaaattaaatgccaatgtagtaggtaaacccgctacttggatt
gctgaacaagctggctttaaagtgccagaaaaaaccaacattcttgcggcagaatgtaaa
gaagtgggcgaaaaagagccattaacacgtgaaaaattatcacctgtgttagcgatttta
aaatctacctcaactgaaaacggctttgaactttcagaagcaatggtgaatttccatggt
ttaggtcactctgcggcaattcacactaaagatgcagctattgcgaaagcgtatggtgat
cgtgtaaaagcgattcgtgtgatctggaattcaccttcaactttcggtggtatcggtgat
gtgtataactctttccttccatctctcacccttggttgtggttcttacggtaaaaactcc
gtaggcaataacgtaagtgcggtcaatttattaaatattaaacgagtgggaagacggaga
aataatatgcaatggttcaaagtgccttcaaaaatctattttgaacgcgactcaatccaa
tatttacaatcaatgaaaggtatggagcgcgtggttattgtgaccgatcgcacgatggtg
gatttaggtttcgtcgaaaaaatcgcaaaacaaattaccgctcgtggcaatcacgttact
taccaattatttgctgatgttgagccagacccatcaatcgaaactgttcgtcgtggtgct
gagttaatccgcaattaccaaccagatacaattattgcattaggtggtggttcagcaatg
gatgctgcaaaagtgatgtggttattctatgaacaaccagaagtggacttccgtgattta
gtacagaaatttatggatatccgtaaacgtgcgttcaaattcccacaattaggtcgtaaa
gcgcgctttgttggtattccaaccacatcgggtacaggttctgaagtgactccatttgcg
gtaatcactgaaggcgataaaaaatacccaatcgcagattattcattaacgccaacagtg
gcaattgttgatcctgcattcgtaatgagcgtgcctgcacacgttgccgcagacacgggg
ttagacgtattaacccacgcaaccgaagcttatgtgtcagtacttgctaacgactttaca
gacggcttagccctacaagcgattaaattagtgtttgaacatttagaacgctcggtgaaa
gagaaagatcctgagtcgcgtgaaaaaatgcacaatgcttcgacaatggcgggtatggca
tttgcaaacgcattcttaggtatgaatcactcacttgcccacaaaattggtggccgtttc
cacacacctcacggccgtaccaatgcagtattaatgccgcatgtgattcgctataacggt
actcgtccacaaaaaaccgcaacgtggccgaaatataactactacaaagcagatgtgaaa
taccaagacatcgcacgtatgttaggtttaccttgttcaacaccagaagaaggcgtgaaa
tctttcgcgaaagcgtgctacgacttagccgtacgtgtgggtatcaaaatgtctttcaaa
gagcaaggcattgatgaaaaagaatggatggatgcacgtcgtcaaatcgcattactcgca
tttgaagaccaatgctcacctgctaaccctcgcttaccagtggttgctgatatggaagtg
attttaaccaatgcttacaatggttatgaggaagggttgtattaa

DBGET integrated database retrieval system