KEGG   Pocillopora damicornis (lace coral): 113666476Help
Entry
113666476         CDS       T05773                                 

Definition
(RefSeq) beta-hexosaminidase subunit beta-like
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00511  Other glycan degradation
pdam00520  Amino sugar and nucleotide sugar metabolism
pdam00531  Glycosaminoglycan degradation
pdam00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pdam00604  Glycosphingolipid biosynthesis - ganglio series
pdam01100  Metabolic pathways
pdam04142  Lysosome
Module
pdam_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    113666476
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    113666476
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    113666476
   00604 Glycosphingolipid biosynthesis - ganglio series
    113666476
   00511 Other glycan degradation
    113666476
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    113666476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113666476
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     113666476
Chaperones and folding catalysts [BR:pdam03110]
 Intramolecular chaperones
  Others
   113666476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b UFD1
Motif
Other DBs
NCBI-GeneID: 113666476
NCBI-ProteinID: XP_027038068
Position
Unknown
AA seq 557 aa AA seqDB search
MTILGREQIEDYFCIMLRSFVCLLLVTVVCLASPSFKRVVRLSDPFGELGWELQELQVED
YVKGSVWPKPQGETPSGAVYKLTPENFQFSITGESSDVLKEAVERYKVLTFPDNMSVSKK
NLSQITKLTVDVVDKYENLTLDSDESYKLEVKAPMSSIFAYTVWGALRGLETFSQIVHQD
LDGFYFANGTQIVDYPRFHHRGFMIDTSRHYLNLSVIFKFLDAMSYGKFNVLHWHVVDDQ
SFPFYSKTFPQLSGVGAFNNQTHIYTEEEVSEILEYARMRGIRVVPEFDTPGHTFSWRSI
RNLLTPCYKGEKPSGSYGPINPIVEANYDFLTKFFREVAERFPDKYIHLGGDEVPFNCWQ
SNPEITEWMTKMGYGKNYYLLEQYYEQKLLKIIGSLEKDYIVWQEVIDNNVEVLPNTVVN
VWKSSPAWPDEMAKVTGKGLKAILSSCWYLNYISYGIDWHKYYQCDPENFNGTDAQKKLV
MGGTGCMWGEFVDGTNILPRTWPRALAVAERLWSSKSVTDLADADSRLWEHRCRYLRRGI
PAEPGVEAKYCRHEWNV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacaatattgggacgggagcagatcgaagattacttttgcatcatgcttcgttcgttc
gtttgtcttcttcttgttactgttgtatgccttgcatctccttcttttaaaagagttgta
agactttctgatccttttggagaacttggatgggaacttcaagaattgcaagtcgaagat
tatgtgaaaggttccgtgtggcctaaacctcaaggagaaactccttcaggtgctgtgtat
aagttgacgccggagaattttcagttttctatcactggtgagagcagcgatgttctcaaa
gaagccgtcgaacgttataaagtgttaacattcccagacaatatgagcgtatcgaagaag
aatttgtcccaaattactaagctaactgttgatgtggttgacaagtatgaaaatctcact
ctggattccgacgaatcttataaactggaagttaaagctccaatgtcctccatttttgct
tatactgtgtggggagcactgcgaggccttgaaacattcagtcagattgttcaccaagat
ctagatggcttttattttgctaatgggacacagattgtggactatcctcgtttccatcac
agaggatttatgatcgacacctctagacactatctaaatctctctgttatctttaagttc
ctggatgccatgtcatatggaaagtttaatgttcttcattggcatgttgtggatgatcaa
tcctttccattttacagcaaaacatttccacagctgagtggagtgggtgcatttaataac
caaacgcatatttatactgaagaagaagttagtgagatcctggaatatgcaagaatgagg
ggaataagagttgttcctgagtttgacacacctggtcacaccttttcttggaggagtatt
cgcaatctactgacaccatgctacaaaggagagaaaccatcaggatcttatggacccatt
aacccaatcgtagaggccaactatgatttcctgactaagttctttcgagaggtggcagaa
agatttccagacaagtacattcacctgggtggtgatgaagtaccctttaactgttggcaa
agcaaccctgagattactgagtggatgactaaaatgggctacggcaaaaactactattta
ctggagcaatactatgaacagaagcttttgaagataatagggagtctagagaaagattac
attgtctggcaagaagtgattgacaataacgtggaagttctgccaaacactgtagttaat
gtttggaaaagcagtccagcttggccagatgagatggctaaggtgacagggaaaggttta
aaagccattctgtcatcttgttggtacttgaactatatttcctacggaatagactggcat
aagtactaccagtgtgatccagagaattttaatgggacggatgcgcagaagaaactggtt
atgggtggaactggttgtatgtggggagaatttgtagatggaacaaatatcttgccgaga
acttggccccgtgcacttgctgttgctgagagactttggagtagcaaatcagtgacagac
ctggctgatgcagacagtaggctttgggaacatcgctgccgctatctcaggcgtggcatc
cctgctgagccaggagtcgaggccaagtattgccgtcacgaatggaatgtctga

DBGET integrated database retrieval system