KEGG   Pocillopora damicornis (lace coral): 113666766
Entry
113666766         CDS       T05773                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: UDP-glucuronosyltransferase 2B31-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00040  Pentose and glucuronate interconversions
pdam00053  Ascorbate and aldarate metabolism
pdam00830  Retinol metabolism
pdam00860  Porphyrin and chlorophyll metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Module
pdam_M00014  Glucuronate pathway (uronate pathway)
pdam_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113666766
   00053 Ascorbate and aldarate metabolism
    113666766
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113666766
   00860 Porphyrin and chlorophyll metabolism
    113666766
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113666766
   00982 Drug metabolism - cytochrome P450
    113666766
   00983 Drug metabolism - other enzymes
    113666766
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdam01003]
    113666766
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113666766
Glycosyltransferases [BR:pdam01003]
 Others
  Hydrophobic molecule
   113666766
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Prominin
Other DBs
NCBI-GeneID: 113666766
NCBI-ProteinID: XP_027038356
Position
Unknown
AA seq 380 aa
LGLCATLVAELLDIPNVVIVSNPPSNFDSSMYRVPMPSSYVPSRLLPFSCEMSYTXRVIN
FFVVNIFQFSLETLSVRSYSSLKEKYNITPEVSYREAVASAELVLFNGHYAVECPQSLLP
GQIILGPIAVKPEPDPLPPDLADFIKDSGGQGFIIASFGSYAKMTISNRTIDVLAAAFGK
LKQKIIWKHKGYIPSSVGPNIKVVNWIPQNDLLAHKDIKAFVSHAGTNSYYESAYHGVPV
VAVPLFIDHFSNARKAEYFGIATVLDHQTMNAEELFEAIQLVMNEPRFKETAMRISRLMK
DSPRTSLEKAGDWIEYVLRHGGAQHLRAQVFNMAWYQYYSLDVIAFLVAIAAIIVMVITL
ACRCLCRACCERCVGKTKND
NT seq 1143 nt   +upstreamnt  +downstreamnt
ttgggactttgtgctactctggtggctgaactcctcgacattcccaatgtggtcattgtt
tcaaatcctccgagcaattttgacagttctatgtacagggtgccaatgccttcatcatac
gttccttcacgtctgttaccgttttcctgtgaaatgtcatatacatagcgtgtgataaac
ttttttgtggtcaacatttttcagttttcattggaaactttgtctgtcagatcctacagc
tctctgaaggaaaaatacaatattactcctgaagtaagctaccgtgaagctgttgccagc
gctgaacttgtgctttttaacggtcattatgcggttgagtgtccacaatctcttctacca
ggtcaaatcatattgggtcccatcgctgtcaaacctgaaccagacccactcccccctgat
ttggcagattttattaaggattcagggggacaagggtttatcattgcctcttttggatcg
tatgcgaaaatgactatttctaacaggacgatcgatgttttggcagcggcttttggaaag
ttgaagcagaaaatcatctggaaacataaaggctacattccgtcatctgtcggtccaaat
atcaaagtagtgaattggataccacagaatgatctgttggctcacaaggatatcaaagct
tttgtgtctcacgccggaactaacagctactatgaatcagcatatcatggggtgcctgtg
gtggctgttccgttgtttatagaccatttttctaatgccagaaaagcagagtactttgga
atagcaacagttttagatcatcaaactatgaatgctgaagagctctttgaggctatacag
ctcgtgatgaatgaaccaagattcaaggaaactgccatgcgcatttcccgtctaatgaaa
gacagtccacggacctccctggagaaagctggtgactggatcgagtatgtactcagacat
ggtggagcccaacacctcagagctcaggtgtttaacatggcctggtaccaatactactca
cttgacgtcatagctttccttgttgccatagcagcgataattgtcatggtgataacactg
gcatgtcgatgcctgtgtcgtgcatgctgtgaaaggtgtgttggcaaaactaaaaacgat
taa

KEGG   Pocillopora damicornis (lace coral): 113670667
Entry
113670667         CDS       T05773                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00040  Pentose and glucuronate interconversions
pdam00053  Ascorbate and aldarate metabolism
pdam00830  Retinol metabolism
pdam00860  Porphyrin and chlorophyll metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Module
pdam_M00014  Glucuronate pathway (uronate pathway)
pdam_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113670667
   00053 Ascorbate and aldarate metabolism
    113670667
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113670667
   00860 Porphyrin and chlorophyll metabolism
    113670667
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113670667
   00982 Drug metabolism - cytochrome P450
    113670667
   00983 Drug metabolism - other enzymes
    113670667
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdam01003]
    113670667
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113670667
Glycosyltransferases [BR:pdam01003]
 Others
  Hydrophobic molecule
   113670667
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_4 Glyco_transf_4
Other DBs
NCBI-GeneID: 113670667
NCBI-ProteinID: XP_027042644
Position
Unknown
AA seq 518 aa
MATLSTITLSLPMLLLAFLFVNSAFSARIAGFHAIGGSQYINTRNVLEELASRGHEVVLF
VASSFKKFKPSEKVPHKIYQVPYKPGFMEKTMLPLELEGKMLELMFKMKDVFQVMCESAL
TSAEVLKELQDCDLLIYDTTSFCAALLGERHNIPLVELLPLSPNGPAASFHMIPMPLSYV
PVLLTRFTNKMTFMERVTNLAYYFGQKLFISMAINKPMNALKLKYNIVVERSFEEAIANV
ELLLILADFALEYPQPLLPGQIMIGPLNVKDAQPLPSDLEEFISNSGDNGFIICSFGSMV
ASSLQREKVDMLAAAFGKLKQRVVWRIKGYIPSDLSSNVKAMDWLPQNDLLAHKDIKAFV
SHVGHNSLYESAYHGVPLVAFPLGGDQDSNVRKAEHLGIGLVVDHKSNNDVKLFETIEKV
INESRFKEKAKHISGLLRDRSQTPLQEACNWIEYTLRHGGAKHLKAQVFKVPWYQYYLLD
VIAFLLAVATVTLIVIRLICRFLCRMCCKKGDGKTKKD
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggcgacgctttcgacaataacgctgtccctacctatgctacttttagcttttctattt
gtgaactcggctttttcagcacggattgcagggtttcatgctataggaggatcacagtac
attaacacgaggaacgttttagaggaactggcctcaaggggacacgaggttgtcctgttt
gttgcatcatcttttaaaaaattcaaaccaagtgagaaagtgccacacaagatttaccaa
gtgccatataaaccaggcttcatggagaaaactatgttaccacttgaactggaggggaaa
atgctagagctgatgttcaaaatgaaagatgtcttccaagttatgtgtgaaagtgcctta
acttctgctgaagttctgaaagagctacaggattgtgacctcctcatttatgatactacc
tctttctgtgctgcattacttggcgaacgccacaacatcccccttgttgagttgttgcct
ttgtctccaaatggcccagctgcttcttttcacatgatacccatgccactttcttatgtt
cctgttctgttaaccagatttaccaataaaatgactttcatggaacgtgtgacaaatttg
gcatattactttggtcagaaactatttatcagcatggcaattaacaagccaatgaatgct
cttaaactcaagtacaacatagtagttgaaaggagctttgaagaagccattgccaatgta
gaactgctgttgatactagcagattttgcgctggaatatccccaacctctgttaccaggc
caaatcatgattgggccactgaatgtgaaagatgctcaacctctcccctctgatttagaa
gaatttataagcaattcaggagataatggttttatcatttgttcctttggttcaatggtg
gcatcaagccttcaaagggagaaagtagacatgttagctgcagcgtttggaaaactgaaa
caaagagttgtttggagaattaaaggttacatcccatctgatctcagctcaaatgtcaaa
gctatggactggttaccccagaatgatcttctggctcacaaggacatcaaagcttttgtc
tcccatgtgggacacaacagtctttacgagtctgcatatcatggagttccattagtggca
tttccactgggtggagaccaggatagtaatgttaggaaagcagagcatttaggcattggt
ttagttgtggatcataagagcaacaatgatgtgaagctgtttgaaacaattgagaaagtt
atcaatgaatcacgatttaaagaaaaagcaaagcacatttctggtttgttgagggatcgt
tcacaaacacctcttcaagaagcttgcaactggatagaatacacactcagacatggcgga
gctaagcacctcaaagcccaagtgtttaaggtcccctggtatcagtattatttacttgat
gttattgccttcctgttagcagtagcaactgttactctcattgtgatacgattaatatgt
agatttttatgccgcatgtgttgtaaaaagggtgatggtaaaactaagaaggattaa

KEGG   Pocillopora damicornis (lace coral): 113671419
Entry
113671419         CDS       T05773                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00040  Pentose and glucuronate interconversions
pdam00053  Ascorbate and aldarate metabolism
pdam00830  Retinol metabolism
pdam00860  Porphyrin and chlorophyll metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Module
pdam_M00014  Glucuronate pathway (uronate pathway)
pdam_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113671419
   00053 Ascorbate and aldarate metabolism
    113671419
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113671419
   00860 Porphyrin and chlorophyll metabolism
    113671419
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113671419
   00982 Drug metabolism - cytochrome P450
    113671419
   00983 Drug metabolism - other enzymes
    113671419
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdam01003]
    113671419
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113671419
Glycosyltransferases [BR:pdam01003]
 Others
  Hydrophobic molecule
   113671419
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_4 Glyco_transf_4
Other DBs
NCBI-GeneID: 113671419
NCBI-ProteinID: XP_027043405
Position
Unknown
AA seq 516 aa
MPNPAYYAFLALLALTLEINSAFSARIAGFHTTGGSQYINTRNILEELATRGHEVVMVVP
SSFDKIKPSKKVPHKIYQAPYKPGFLEDTVIPLELEGKMMEVLFKMSKIQETLCESALNS
TEVLKELKNYDLIIYDSGAFCAALIGELLKIQRIELFPYPPNSPDAFYHMIPSPISYVPQ
LPTGFTHKMTFKERLMNLGSYIGERLFLSIVYNRPMNALKMRYNITPERSFEGAVADVEL
LLIMADFALEYPQPLLPGHVMVGPLNVKDTQPLPPDLEEFVNNSGGHGFIIVSFGSMVAS
ILPREKVDMLADAFGKLKQKVVWRLKGYIPSSLKANIKAVQWLPQNDLLAHKDIKAFVSH
VGHNSLYESAYHGVPVVAFPLGGDQDSNAKKAEHFGLGLIVDHKNCSTQQLFETIEKVVG
EPRFKTKAMHISGLLKDHPYTPLQETCNWIEYVVRHGGARHLRAQVFDIPWYQYYLLDVI
AFLVTIVTLVVLVIRFICKCLCRVCCKKGDTKPKKE
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgcccaatcctgcttactacgcttttttggcacttttagctcttacgctagaaattaac
tcagctttttcagcgcgaatagctggtttccatactacaggaggatcacagtacataaac
accagaaacattctagaagagttagcaactcgtggacacgaggttgtaatggttgttcca
tcatcttttgataaaatcaagccgagtaagaaggtacctcacaagatttaccaagcacct
tataaaccaggcttcttagaagatacagtaataccccttgaactggaaggaaaaatgatg
gaggtacttttcaagatgagcaagattcaggaaacattatgtgaaagtgcactaaactcc
actgaagttctcaaggaattgaaaaactatgatcttatcatctatgatagcggagcattc
tgtgcggcgttaattggtgaactcctcaagattcagcgcattgagctgttcccttacccc
cctaacagtccagatgccttttatcacatgataccctcgccaatttcttatgttcctcaa
cttcctacgggatttactcataaaatgactttcaaggagcgtttgatgaatctgggatca
tacattggcgagagactgtttttgagcatagtctataacagaccaatgaatgctctaaaa
atgagatacaacattacgcctgaaagaagctttgagggggctgttgctgatgtagaacta
cttttaatcatggcagattttgcactggaatacccacaacctctgttgccaggtcatgtt
atggttggaccactaaatgtcaaagatactcaacccctcccccctgatttagaagagttt
gtcaataattcagggggtcatggttttattattgtttcctttggttcaatggtggcttca
atccttccaagagagaaagtggatatgctagctgatgcatttggaaaactgaaacaaaaa
gttgtgtggagacttaaaggttatatcccatcctcccttaaagcaaacatcaaagcagtt
caatggttacctcagaatgatctcttagcacacaaggacatcaaagcttttgtctcccat
gtgggacataacagtttgtatgagtcagcataccatggggtccctgtggtagcctttcca
ttgggtggagaccaggatagcaatgctaagaaagctgaacattttggccttggtttaatt
gttgatcataaaaactgcagtacgcaacaactgtttgaaacaattgagaaagttgtaggg
gaaccacgatttaaaacaaaagcaatgcacatctctgggcttttgaaggatcatccttac
acacctctacaagaaacctgcaactggattgagtatgtagtcagacatggtggagccaga
cacctcagagctcaagtgtttgacattccttggtaccagtactacttacttgacgtcata
gctttccttgttactatagtaaccttagttgtcctggtgataagattcatatgtaagtgt
ttgtgtagagtgtgctgtaaaaagggcgacaccaaacccaagaaggagtaa

KEGG   Pocillopora damicornis (lace coral): 113672610
Entry
113672610         CDS       T05773                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00040  Pentose and glucuronate interconversions
pdam00053  Ascorbate and aldarate metabolism
pdam00830  Retinol metabolism
pdam00860  Porphyrin and chlorophyll metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Module
pdam_M00014  Glucuronate pathway (uronate pathway)
pdam_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113672610
   00053 Ascorbate and aldarate metabolism
    113672610
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113672610
   00860 Porphyrin and chlorophyll metabolism
    113672610
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113672610
   00982 Drug metabolism - cytochrome P450
    113672610
   00983 Drug metabolism - other enzymes
    113672610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdam01003]
    113672610
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113672610
Glycosyltransferases [BR:pdam01003]
 Others
  Hydrophobic molecule
   113672610
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 113672610
NCBI-ProteinID: XP_027044719
Position
Unknown
AA seq 515 aa
MVVTVLTLLCCLVTLNHASNSHIVGIPSIGTSHGLVYVKIGRELTRRGYRYSLLVPAWQV
NEIGPNLAGIAVKSYDTHTNGNDLEKVIIKEAEGKLNITERNDFWKSTCEDLLNDRALLK
SLGRVDLIVCDITSICCAIVADLLKVNRVDLAPIGFVDPYVSFIHNFPSPVAYVPHGTVK
LPKRMSFLERLQNLLLYILGYVMHEFVFMPPFEDLWRTHVKDSKFSSLSEVFRATGLLII
PNDFALDFPRPFGAHVKVVGPILPEKPKPLPSDKESFISDGDLTELVVVSFGTVISNFKP
EFVDSIAKGLMQVPSKVIWKYKGELSLLPQNLSKNIKIVPWMEQNDLLGHTATKVFFTHG
GLNSILEGTYHGTPMVVLPLFGDQPANAMKVHEAGIGVILDLQNLTPNAVTNAILEVLRN
SSYKEKAERVSRLIHHRRVTPTEEACDWIEYGLHNNAGLHLRSEADNLYFFQVYLLDVLL
LIVATVVCVMVLFCFCLKYCLQHIIQKCSKKSKAE
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggttgttacagtactaaccttgctatgttgtctggttactcttaaccatgcttctaat
agtcatatcgttggaataccaagcattggaacaagtcatggacttgtttacgtcaaaatc
ggacgagagctgactaggagaggttacagatacagtcttcttgtaccagcctggcaagtg
aatgaaattggacctaatttggctggcattgcagtgaaatcttacgacactcatacaaat
gggaatgatttggaaaaagtgataataaaagaagccgaaggcaagctaaatatcaccgag
agaaatgatttttggaagtctacgtgtgaggatttgctgaatgacagagctctcttgaaa
agcttgggacgggtagacttgattgtttgcgatatcacaagtatatgttgtgctatagtg
gcagacttgctgaaagtgaatcgcgttgacttggctcccatcggatttgtagatccctat
gtgagttttattcacaatttcccttctcccgtggcctatgttccgcacggaactgtcaaa
cttccaaagagaatgtcatttttggaaaggttacaaaacctgttgttgtatatcttaggg
tatgttatgcacgagtttgtttttatgccaccctttgaagatttgtggaggactcatgtc
aaagacagtaagttttctagtctcagtgaagtattcagagccacaggattgttaataatt
ccaaacgactttgctttagattttccaaggccttttggagcccatgtgaaagtggttggg
cccatactcccggaaaagcctaaaccacttccgtcagacaaagaaagtttcatctctgat
ggagacttgacagaattagtagttgtttcatttgggactgtcatttcaaatttcaaaccg
gagtttgttgatagcattgcaaaagggctcatgcaggtcccttctaaagttatatggaag
tataaaggtgagttgagcttactgcctcaaaacctgagcaaaaatatcaaaattgtacca
tggatggaacaaaatgatcttcttggacatacagctacaaaggtctttttcactcacggg
ggcttgaacagtatacttgagggcacttatcatgggacacctatggttgttttacctctc
tttggtgaccaaccagctaatgctatgaaagtgcatgaggctggtattggtgtgatactg
gacttgcaaaatttaacaccaaatgcagtaacaaatgcaatacttgaagttctcagaaat
tccagttataaagaaaaagctgaaagagtttctagattgattcatcacaggagagtcaca
ccaactgaagaggcctgtgactggattgaatatgggcttcataacaatgcaggactgcat
ttaaggagtgaagctgacaacttgtacttttttcaagtttatctcttagatgtgttgctt
ctcatagtagcgactgttgtttgtgttatggttttgttctgcttttgtctgaagtattgc
ttacaacacatcatacaaaagtgttctaaaaaatcaaaggcagagtaa

KEGG   Pocillopora damicornis (lace coral): 113675379
Entry
113675379         CDS       T05773                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A2-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00040  Pentose and glucuronate interconversions
pdam00053  Ascorbate and aldarate metabolism
pdam00830  Retinol metabolism
pdam00860  Porphyrin and chlorophyll metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Module
pdam_M00014  Glucuronate pathway (uronate pathway)
pdam_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113675379
   00053 Ascorbate and aldarate metabolism
    113675379
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113675379
   00860 Porphyrin and chlorophyll metabolism
    113675379
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113675379
   00982 Drug metabolism - cytochrome P450
    113675379
   00983 Drug metabolism - other enzymes
    113675379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdam01003]
    113675379
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113675379
Glycosyltransferases [BR:pdam01003]
 Others
  Hydrophobic molecule
   113675379
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Glyco_transf_4
Other DBs
NCBI-GeneID: 113675379
NCBI-ProteinID: XP_027047751
Position
Unknown
AA seq 409 aa
MALLTMLLLSLTVNSAFSARIAAFCTIGKSQYMNLRGILEELASRGHEVTMVIPSTEKVQ
LSDRVQHKIFKIPYEPGFMENELLKLELEGDKFRLLSKMMEVLSTVCESVLNDTKIMEEL
RGYDLLVYDVLGVCGALIGDRLGVQRVQMLVTPNNPFDHMIPTPLSYIPMMVLPGFTDKM
TFLQRVTNVVAYIGLGLFKDLLFARPMDALKLKYNITTERSYQETVDGVELVLIRADFAI
EYAQPLLPGNIMVGPLSVREGKPLPPDLEEFVDNPGGDGFIIVSFGSNLASILPRTVVDM
LATAFGKLKQRVVWRLKGYIPSFLGSNIKVVEWLPQNDLLAHKNIKAFVSHVGHNSLYES
AYHGVPLVAFPQFADQHFNAKQAENLGIGLAVDPKGCNAQELFDTIQRV
NT seq 1226 nt   +upstreamnt  +downstreamnt
atggcgttgttgacaatgcttttgctgtcattgacagtcaattcggctttttcagcacgg
attgctgccttttgcacgataggaaaatcacagtatatgaacttaaggggtattctggaa
gaattggcttctcgaggacatgaggtaactatggtcattccgtcgactgagaaagttcag
ctcagtgaccgagtacaacacaagattttcaaaataccgtacgagcctggcttcatggaa
aatgaattgctgaagctcgaattagaaggtgacaagtttcggcttctatccaaaatgatg
gaggtgctatccaccgtgtgtgaaagtgttttgaacgatacaaagattatggaggaactt
agaggctatgatcttcttgtgtacgatgtacttggagtatgtggtgcccttatcggtgac
cgccttggtgttcagagggtacaaatgttggtgactcctaataacccttttgaccatatg
atacccactcctctttcttacatccccatgatggtgcttccaggattcacggacaaaatg
acatttttgcaacgagttaccaacgtagtcgcgtacattggactaggcttgttcaaagat
ctgctatttgcaagaccaatggatgccttgaaactcaaatacaacatcacaactgaaaga
agctaccaggagactgttgacggcgtggaacttgttttaatcagggcagattttgcgata
gagtacgctcaacctcttttgccagggaatattatggttggaccactgagtgtcagagaa
ggtaaaccactccctcctgatctagaagaattcgtcgataatccaggaggggatggtttt
atcattgtttcctttggatcaaacttggcttcgattcttccaagaacagttgtggacatg
ttagcaacagcatttggaaagttgaaacagagagttgtttggagacttaaaggttatatt
ccatcgttcttgggatctaacattaaagtcgtggagtggttacctcagaatgatctattg
gctcacaagaatatcaaagcttttgtctcccatgttggacacaacagcctttatgagtca
gcataccacggagttcctttagtagctttccctcaatttgcagaccaacatttcaatgcc
aagcaagcagaaaatttgggtattggtttggctgtggatcctaaaggctgtaacgctcag
gagctttttgacacaattcaacgcgt

KEGG   Pocillopora damicornis (lace coral): 113676365
Entry
113676365         CDS       T05773                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-2-like isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00040  Pentose and glucuronate interconversions
pdam00053  Ascorbate and aldarate metabolism
pdam00830  Retinol metabolism
pdam00860  Porphyrin and chlorophyll metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Module
pdam_M00014  Glucuronate pathway (uronate pathway)
pdam_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113676365
   00053 Ascorbate and aldarate metabolism
    113676365
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113676365
   00860 Porphyrin and chlorophyll metabolism
    113676365
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113676365
   00982 Drug metabolism - cytochrome P450
    113676365
   00983 Drug metabolism - other enzymes
    113676365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdam01003]
    113676365
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113676365
Glycosyltransferases [BR:pdam01003]
 Others
  Hydrophobic molecule
   113676365
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_4
Other DBs
NCBI-GeneID: 113676365
NCBI-ProteinID: XP_027048817
Position
Unknown
AA seq 516 aa
MAEIKSFLLLSSVILSMDLSFSARIAGFSGFYSGSHYFTIKKVMEELFSRGHEVVLVRPA
VRDAPPSNEQKIPHRTFLTPYDEKDTENTAITAMEGKMWKTINRLHEMQRVNCEYMLNDT
VLLQELKSFDLIVYESFSFCAVLVSELLGIPKVVIFSGPPNGPGTFAHNIPHPVSYIPAP
MTLFTSEMTFLQRLMNFGTYKLTQSAEQVLIARYMGSLKEEYNITPEKSYQEAAGNAELV
LFLADFALEYPQPLLPGQIMVGAISAKGDPNTLPPELKDFINSSGGHGFIIASFGSYVQT
IIAKEKIDVLAEGFGKVKQNVIWKLKGYIPPSLNKNIKVMSWIPQNDLLAHKDIKAFVSH
VGHNSLYESAYHGVPVVAVPLYADQFPNARKAEHFGIATVLDHKIMNAKQLSEAIQHVID
EPRFKRESKRISRLMKDNPRTPLEKAGDWIEYVHRHGGAQHLRAQVFNIPWYQYYLLDVI
AFLVAIVALVVMVIRFACRCFCKACCKSSGTKTKKE
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggccgagataaaatcgttcttacttctttcttcggttatattatcgatggacttatca
ttttcggccagaattgcaggttttagcggattttattcgggatcccattattttacgatc
aaaaaggttatggaggagttgttctcccgaggtcacgaggtggtgcttgttcgaccagca
gttcgtgatgcaccaccaagtaatgagcagaaaattccccacaggacattcctgactcca
tacgatgaaaaagatacagagaacacagcgataacagccatggaaggcaaaatgtggaag
acaataaatcgcttacatgaaatgcaaagagtcaattgtgaatacatgctgaatgacaca
gtgctacttcaagaactgaaaagctttgacttgatagtttatgagagtttttccttctgt
gctgttttggtctctgagcttcttggcattccaaaagtagtcatattttctggtcctcca
aatggtccaggaacttttgcccataatattccccacccagtatcatacattccagcacca
atgactttatttacaagcgaaatgacatttttacagcgtcttatgaactttggtacatat
aaactcacacagtctgcagaacaagttttaattgccaggtatatgggttctctgaaagag
gaatacaacatcactcctgagaagagctaccaagaagctgctggcaatgctgagctggtg
ctgtttcttgctgattttgcactggagtatccacagcctcttttgccaggtcaaattatg
gtgggtgccatttctgcaaaaggggatcctaatacacttccccctgaattgaaagatttt
atcaacagttcagggggacatgggttcattattgcctcttttgggtcatatgtacaaaca
atcatagctaaggagaagatcgatgtcttggctgaaggttttggaaaggtgaagcagaac
gtcatatggaaactgaaagggtacatacctccatctctcaataaaaacataaaagtaatg
agctggatacctcagaatgatctgttggctcacaaggatatcaaagcttttgtatctcat
gtgggacacaacagcctttatgagtcagcatatcatggggtgcctgtggtggctgtgccc
ttgtatgcagaccaattccctaatgccaggaaggcagaacactttggaatagcaacagtt
ttagatcacaaaattatgaatgctaaacaactttcagaggcaattcagcatgttattgat
gaaccaagattcaagagagaatccaaacgcatttctcgtcttatgaaagacaatccaagg
acccccctggagaaagctggggactggatagagtatgtacacagacatggtggagcccaa
cacctcagagctcaagtgtttaacatcccttggtaccagtactacttacttgacgtcata
gctttccttgttgctatagtagcattagttgtcatggtgattaggttcgcatgcaggtgt
ttttgcaaagcatgctgtaaaagtagtggtacaaaaactaagaaggagtag

KEGG   Pocillopora damicornis (lace coral): 113679949
Entry
113679949         CDS       T05773                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B33-like isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00040  Pentose and glucuronate interconversions
pdam00053  Ascorbate and aldarate metabolism
pdam00830  Retinol metabolism
pdam00860  Porphyrin and chlorophyll metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Module
pdam_M00014  Glucuronate pathway (uronate pathway)
pdam_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113679949
   00053 Ascorbate and aldarate metabolism
    113679949
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113679949
   00860 Porphyrin and chlorophyll metabolism
    113679949
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113679949
   00982 Drug metabolism - cytochrome P450
    113679949
   00983 Drug metabolism - other enzymes
    113679949
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdam01003]
    113679949
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113679949
Glycosyltransferases [BR:pdam01003]
 Others
  Hydrophobic molecule
   113679949
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Cyt_b-c1_8 Glyco_transf_4
Other DBs
NCBI-GeneID: 113679949
NCBI-ProteinID: XP_027052733
Position
Unknown
AA seq 520 aa
MYLVFSELHKMAAIIISVFFATLSSSLAANIVTIPMFGKSHYMFVSRLGQELAERGHQVK
IYVGETQTYAVNNSLVRVFNDDNFAPVLRSASTSSPTFKSLSPRQEWQMLLMFQSVYCDD
LFSNTDVMEEISHADIIVGEFIYLCSTLIADKFSLPLVLISAATLDIPSAFAFGLPAPPS
YIPQYGVSLSDKLTFSERAWSLLQWIILYGSYIYDTCPPYEKIKAKYAITPSKSIQETLG
RVDLIIAQMNFLIDHSRPLYPNTRVVGPFLASPAKSLPSEIDQFFQKAGDEGVILVSFGT
VVGALSDSSLKIMAETFSKLPQKIIWKLKPNDISKITVSDNIKLLPWLPQNDILGHPKTR
LFIAHAGINGMLESTYHGVPMICSPFFGDQPHNAQAAKRAGFAEVVDLEATSTEEFVNLI
QKVLTDPSYREKAKRISKSVQLLPRSPVKEAADWVEYTQAQGGLQYLRPRGLDLPLYKLF
LLDVWSVVLLVSVVVLLVIIIMFTSVIRCLSGSSRKEKVN
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgtatttagtgtttagtgaattgcacaagatggcggctattattatatcggtgtttttc
gctactctttccagctctctggctgcaaatatagtcacgattcccatgtttgggaagagc
cattacatgtttgtctcccgtcttggtcaggaactggcggagagaggtcatcaggtaaag
atatatgtgggagagacacaaacgtatgctgtaaataattcacttgtacgagtcttcaat
gatgacaattttgctccagtgttgcggtcagcatcaacaagttctccaaccttcaaatcg
ctaagcccaagacaagaatggcaaatgctcctaatgttccaatccgtttactgtgatgac
ctttttagtaatacagatgtcatggaagagatatctcacgcagacatcattgttggtgaa
tttatttacctctgctcaactttaattgcggacaaattctcacttccacttgttctaata
tcagctgccacattggatattccctcagcattcgccttcggcttacctgcccctccttcc
tacataccacagtatggagtttctctttcagacaagctaacattttcggaaagagcatgg
agtcttttacaatggattattctatatggatcttacatttacgatacgtgtccgccttat
gagaagatcaaggcaaagtacgccattacacccagcaagagcatacaagaaacacttggc
agagttgacttgataatcgcacagatgaatttcttgatagatcattcaaggcctctttat
ccgaatacacgggttgtgggtccattccttgctagtccagctaaatctctaccaagcgag
atagatcagttctttcagaaggctggggacgagggcgtgatcttggtgtcgtttggtacc
gtggttggagcgctgagtgattcatcactgaaaattatggctgaaactttctccaaacta
ccacagaagattatatggaaacttaagcccaatgacatttcaaaaatcaccgtcagcgac
aacatcaaactgttgccatggctaccccagaatgacattcttggccaccctaagacacgg
ctatttatcgcacacgcaggaatcaatggaatgctagaatcaacctaccatggtgttcct
atgatatgttcacctttcttcggagatcaaccacacaacgcccaggctgcaaagcgggcc
gggtttgctgaggtggtggaccttgaagccacatcaacagaggagtttgttaatttgata
cagaaggttttaacagatccaagctaccgagagaaagcaaagcgaatatcaaaatctgtt
cagctgttgccacgttcacccgtcaaggaagccgctgattgggtggaatatacacaggct
caaggtggtttacagtacctaagaccacgtggcctggatctgccgctttataagctcttc
cttcttgatgtttggtccgtcgtgctcttagtttcagttgttgttttattggtcatcatt
atcatgtttacatctgtaatacggtgtttatcagggtcctcaaggaaagagaaggttaat
tga

KEGG   Pocillopora damicornis (lace coral): 113680799
Entry
113680799         CDS       T05773                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00040  Pentose and glucuronate interconversions
pdam00053  Ascorbate and aldarate metabolism
pdam00830  Retinol metabolism
pdam00860  Porphyrin and chlorophyll metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Module
pdam_M00014  Glucuronate pathway (uronate pathway)
pdam_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113680799
   00053 Ascorbate and aldarate metabolism
    113680799
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113680799
   00860 Porphyrin and chlorophyll metabolism
    113680799
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113680799
   00982 Drug metabolism - cytochrome P450
    113680799
   00983 Drug metabolism - other enzymes
    113680799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdam01003]
    113680799
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113680799
Glycosyltransferases [BR:pdam01003]
 Others
  Hydrophobic molecule
   113680799
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 113680799
NCBI-ProteinID: XP_027053654
Position
Unknown
AA seq 501 aa
MRLLILSLLCSFVYLLALQTSCFAAKFTMFPMVGRSHYLVLARIGEELESRGHEVLIFVG
DCEKFAAKDPRVRTFKCSEDLTKLDPTKIDHLMKFWFDNCDAILSNPEIMNRVKSSDAVI
GDAAFQCSYLIADKFSLPHVTVLMSPLSTGSVLQLNFAQLPSYIPQFTSGFTDHMNFLQR
VKNTMQHLFHQLMVLPKIDNVYGPLKKKYNITPEKSLRETYQKIDLVLVQSDPLDYPRFH
LPNTKLVGPLLSSPAKPLPGDLQQFVMGSGDEGVILVSFGSILSQIDDQTIERMAAVFSS
LPQRVIWKLDAEGKSLHLGDNVKVSSWLPQNDILGHPKTRLFIGHAGMNGMLEAAYHGVP
MICVPFFADQFDNSVAAKHFGMAEILHKESITEESLVTLISTVLNNPSYRENAARISKSI
KLRPRSAIEEAAEWVEYAQAQGDLSFLRPRSLDLPFYQLYLMDVFTLFIFLLIIVVAAVY
LLLRCSYRLCLRKKLIKEKSF
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaggttattaattctctcgctcctctgcagctttgtatatttgctcgcacttcagact
agctgctttgctgcaaagtttacgatgtttcctatggtgggtcggagtcactacttagtt
cttgcgaggataggagaagaattggaaagcagaggtcatgaggtgttgatttttgtgggg
gattgtgaaaagtttgctgcgaaggacccccgtgtacgaacattcaagtgctcagaagat
ctcaccaaacttgacccaaccaagatagatcacttgatgaagttttggtttgacaactgc
gatgcaatactcagcaaccctgagatcatgaaccgagtcaaatcttccgatgctgttatt
ggagatgctgcgttccagtgctcgtatttgatcgccgataaattctccttaccacatgtt
acagtcttgatgagtcctctcagtaccggttcggtgttgcagttaaactttgcacaactt
ccgtcctacataccccagttcacctccggattcaccgaccacatgaattttcttcagaga
gtgaagaataccatgcaacacttatttcatcaattgatggttcttccgaaaatagacaac
gtctacggaccgctaaagaagaagtataacatcacaccagagaaatccctccgagagact
taccaaaaaattgaccttgtccttgttcaatcggatcccctcgattatccaaggtttcat
ttaccgaatactaaactggttggtccattactctcaagtccggctaaacccctcccaggt
gatcttcaacagtttgtcatggggtctggggacgaaggtgttatacttgtgtcgtttgga
tcgattctgtctcagatagacgatcaaacaattgaaagaatggcagctgtgttttctagc
ttaccacagagagttatctggaaacttgatgcagagggcaaaagtttgcaccttggcgac
aacgtcaaagtgtcttcctggcttccacagaacgacattctcggtcatccaaagacacgt
ttgttcattggccatgctggaatgaatggaatgttggaggctgcttaccatggagtccct
atgatttgtgttcccttttttgccgaccagtttgataactctgtggcggcaaagcacttt
gggatggcggagattttgcataaggagtcaataactgaggagagtcttgtgacgttaata
agcactgttctcaacaatccaagctaccgcgagaatgctgctagaatttccaagtctatc
aagttgcgcccgcgttctgccatcgaggaggccgctgaatgggtggagtacgcgcaggct
caaggtgacttatcgttcctcagaccacgaagcctggatctaccattttatcagctttac
cttatggacgtattcactctttttattttcctgttaatcatcgttgtagccgctgtttat
ttactgctcaggtgttcctatcgcttgtgcctcaggaaaaagctgataaaagaaaagtcg
ttctaa

DBGET integrated database retrieval system