KEGG   Pocillopora damicornis (lace coral): 113667048
Entry
113667048         CDS       T05773                                 

Definition
(RefSeq) diacylglycerol O-acyltransferase 1-like
  KO
K11155  diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00561  Glycerolipid metabolism
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Module
pdam_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    113667048
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113667048
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     113667048
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     113667048
    2.3.1.76  retinol O-fatty-acyltransferase
     113667048
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 113667048
NCBI-ProteinID: XP_027038644
Position
Unknown
AA seq 453 aa
MTSSTTRKRSTPKRAENTTEAKASTKSQAKESDYGKRVHEKEESLLTSTSGFDNYRGLIN
LCLILLVLSNFRVALDNLLKYGLLIDPLQVITIFLEDPYHWPSASLVIFSNVLIQLTFVI
EKLLAAGKISERIGRISHMFLLLLMLFVPCTVILVYLPPPWAANIAVFWYTIVWLKLISY
VSVNLWYRLGLMKHEEKGHVANGKPETLPLVKYPENLTQKDLYYFIFAPTLCYELNYPRS
ERIRKRFLLRRLAEFFFIIGIVIGAFQQWIVPTVKNSMKPIQEMDVGRGLERIMKLAVPN
HLLWLLFFYAFFHSGLNILAELLRFGDRTFYRDWWNSPNVAYFWQNWNIPVHRWARRHLY
IPMLRSGYSSLQAQVAVFLLSAFFHEFLVSVPLRLFRFWAFLAMLAQVPLHLLVKKFLGD
YPNYGNMVVWLSIILGQPLAILTYVHDYYITHQ
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgacatcttccacaacgaggaagcgatcaacgcccaaaagggccgaaaacaccacagag
gcgaaggcatcaacgaaatctcaagcaaaagaatcggattatggaaaacgggttcacgag
aaggaagaatctcttttaacatcgaccagtgggtttgacaactacagaggactaataaac
ttatgtcttattctcttggtgctctccaatttcagggtagcacttgataatttactgaag
tatggcttgctgatagatcctcttcaagtaataactatcttcttggaggatccataccac
tggccatcagcatcacttgtgatcttttcaaatgtgcttattcagttgacgtttgtcatt
gagaagcttttggctgcaggcaaaatttctgagaggattgggcggatatcccatatgttt
ttgctgctgttaatgttatttgtgccatgtacagtgattttggtttatcttccaccacca
tgggcagctaacattgctgtcttttggtataccattgtctggttgaaacttatcagctat
gtcagtgttaacctctggtacaggttgggattgatgaaacatgaagagaaaggtcatgtt
gcaaatgggaaacctgaaactcttcctttggtgaagtatcctgaaaatctcactcagaaa
gatttatattacttcatttttgcaccaactttgtgttatgagctcaattatcccagaagt
gaaaggatacggaagcgttttcttttgagaagactggctgaattttttttcattattggc
attgtaattggagcatttcagcagtggattgtacctacagtaaaaaactctatgaaacca
atacaggagatggatgtaggcagaggccttgagagaataatgaaacttgcagttcccaac
cacttgttatggctgctgttcttctacgccttcttccacagtggccttaacattttagca
gaactattaaggtttggtgacaggactttctatcgagactggtggaattctccaaatgtg
gcatacttctggcaaaactggaatatacctgttcatcgctgggcgaggagacatctctat
attcccatgttaaggtcaggttattcatctctccaagcgcaagttgctgtgtttttacta
tctgcatttttccacgagtttttagtcagtgtgcccttacgactgttcagattctgggcg
ttcctagctatgctagctcaggtgcctctccatttgctcgtgaaaaaatttcttggcgat
tatccaaactatggtaacatggtggtatggctttcaatcattcttggccagccgttggca
attctgacttatgtccatgattattatatcactcaccaatag

DBGET integrated database retrieval system