KEGG   Pocillopora damicornis (lace coral): 113667165Help
Entry
113667165         CDS       T05773                                 

Definition
(RefSeq) dipeptidyl peptidase 3-like isoform X1
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113667165
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     113667165
Peptidases and inhibitors [BR:pdam01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   113667165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 113667165
NCBI-ProteinID: XP_027038756
Position
Unknown
AA seq 730 aa AA seqDB search
MAGEVDMSQYTISKEVDVNLLNCRTAFSGLTEKEKLYAHYLCCASWEGALICLLQTSPES
PGIFLLLQELFQAESVEELQARVLKSENGSSKEEFENFLIYAAAFYGNVGNYKSFGDTKF
VPDLPKEKLESVVFSSKAYETNAKRVEQLWGDCGDMMYSLTPKCRQLGLGEQGLSTYYSS
NCAKADAELAQEFMKEKDIETYNTRLFKEEKDGHVTYILRIASVAKTAEPYPGADGEEDK
VVTVLGSHEFKGCTFRVERGDYSGLLKRVVENLEKAKEFSANNNELSMIKSYIHSFNTGS
IQAHKDGSRFWIRDKGPIVETYIGFIETYRDPSGVRAEYEGFVSVVNKEMSAKFASLVSK
AEKLLPELPWPPAYEKDKFLRPDFTSLDVLGFGSSGIPAGINIPNYDEIRQEEGFKNVSL
GNVLAAHSVDKKVTFLSDEDQELFTKLKAPSFEVQVGLHELLGHGSGKLFVKKNDGTYNF
DLDSVMHTETGEKISSWYTDGETWYTRFAELSPSYEECRAECVGIYLCTSTEVLRIFGHE
GTDADNIIYINWLNMVRAGLLGLEFYTPENNKWRQAHMQARYVILQVLLEAGENLVQVTS
ITGSDGKPDVLVTLDRTKIESVGRPAIGNFLRKLQVYKSTADYDAGKALYDQYSAVDEEY
LALRQTVLARKTPRRMFVQCHTSITGDNDVSLTEFEASPAGMIKSFTTRFPSEDSVLEEL
WRAEMPYHKL
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgaggtggatatgtcccagtacaccatttcaaaggaagttgatgtaaatctt
cttaattgtagaacagctttttctgggctcacagagaaagaaaagctctacgctcattac
ctgtgttgtgcctcatgggagggcgctctcatttgtttgctccaaacgtcgccggaatct
cctggaatcttccttcttttacaagaattgttccaagcagaatccgtcgaggagctccaa
gcaagagttttaaaatccgaaaatggctcctccaaggaagaatttgagaattttctgatt
tatgctgcagcattctatggtaatgttggcaactacaaatcatttggcgacacaaagttt
gttcctgatttaccaaaggaaaaattggaaagtgtagttttctcaagtaaagcttacgag
acaaatgcaaaaagggtggagcaattgtggggtgactgtggagatatgatgtattcactt
acccccaaatgtcgacaacttggccttggtgagcagggtctttccacatattattccagt
aattgtgcaaaggctgatgctgaattggcgcaagagtttatgaaagaaaaggacatagaa
acctataacacaagattatttaaggaggagaaagatggtcatgtgacatacattcttcgc
atagcttcagtggcaaaaactgcagagccgtatcctggagcagatggggaagaagacaaa
gtagtaacagttttgggttctcatgaattcaaaggctgcaccttcagggtggagagagga
gattattctggtctactgaaaagagttgtcgaaaatctagagaaagctaaggaatttagt
gctaataacaatgaactgtccatgataaaaagctacatacacagcttcaacacaggctcc
attcaggctcataaggatggctctaggttctggatcagagataagggacccattgttgaa
acttacataggatttattgagacatacagagacccttcaggtgttcgagcagagtatgaa
gggtttgtgtcagttgttaacaaagagatgagtgccaagtttgcatcactagtgtccaaa
gctgagaagttgcttcctgagctgccatggcctcctgcgtatgagaaggacaagttttta
agaccagactttacttctcttgatgtgctgggctttggaagcagtggtataccagctgga
attaacattcctaattatgatgaaattcgtcaagaagaaggctttaaaaatgtatctttg
ggaaatgtactggcagctcattcagttgacaagaaggtcactttccttagtgatgaggat
caagagctgtttacaaagcttaaggccccatcctttgaggtacaagttggccttcatgaa
ctcttgggccatggaagtggcaagctctttgttaagaaaaatgatggcacatataatttt
gaccttgacagtgtgatgcacacagaaactggagaaaagatctccagctggtatactgac
ggggagacctggtacacacggtttgctgaattaagtccatcttatgaggaatgccgtgca
gagtgcgtgggaatctacctttgtacctctacggaagtactgagaatatttgggcatgaa
ggtactgatgctgataacataatttacatcaactggctgaatatggtccgtgcaggtctg
ttaggactggaattttatacccctgagaataacaaatggcggcaggctcacatgcaagca
cgatatgtcattctacaagttctccttgaagcaggtgaaaatttagtacaagtgaccagt
atcacagggtcagatggtaaaccagatgtgttggtgacactggatagaacaaagattgaa
tctgtgggaaggccggctattggaaacttcctcagaaaactacaggtgtacaagtcaaca
gcagattatgatgctggcaaagctttgtatgatcaatactcagccgtagatgaggaatat
ttagcactgcgtcagacagttcttgctcgcaagactccacgaaggatgtttgttcaatgc
catacaagcattacaggagacaatgatgttagtttaacagaatttgaagcaagccctgct
gggatgatcaagtcattcacaactcgctttccaagtgaagacagtgtgttagaagagcta
tggagagctgagatgccataccacaagttgtga

DBGET integrated database retrieval system