KEGG   Pocillopora damicornis (lace coral): 113667168
Entry
113667168         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 13-like
  KO
K11161  retinol dehydrogenase 13 [EC:1.1.1.300]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
pdam01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113667168
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     113667168
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GDP_Man_Dehyd Shikimate_DH Sacchrp_dh_NADP NAD_binding_10 DUF1776 Pyr_redox_3
Other DBs
NCBI-GeneID: 113667168
NCBI-ProteinID: XP_027038759
Position
Unknown
AA seq 323 aa
MAGIWKLAGPLSTVAAGAGGIFLLRNYFAGGVCNCKEKLNGKTVIVTGANTGIGRETALD
LARRGARVILACRDLEKANTAAKEIRKTTGNDKVFVKMLDLASLKSVRTFAEEFHQTEDR
LDILINNAGIMRCPYWKTEDGFEMQLGVNHLGHFLLTNLLLDMLERSQPSRIINVSSLAH
VRGKIHFDDLQSEQEYSPSSAYSQSKLANVLFTRELSKRLEDTDILVTAVHPGVVKTELA
RHTTFAKSKIASLTLAPLAWLFFKTSLQGAQTTIYCAVADDVESGLYYSDCKPKEPADQG
KDDRAAKKLWEVSADLVGLEKTT
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcgggcatctggaagttagcaggacctctgtcaactgtagctgctggtgctggtggc
attttcctgctgagaaattacttcgctggaggagtttgtaattgtaaagagaaactaaat
ggtaagacagtaatcgtcacaggggcaaacacaggaatcgggcgagaaacagccttagat
ctcgcccgaaggggcgcccgtgtaatcctagcttgccgagacctcgagaaggcaaacact
gctgctaaagaaatacgaaaaacaacaggaaatgacaaggtattcgtgaaaatgctcgat
cttgcgtcgctcaagtcagtgagaacattcgcggaggaattccaccaaactgaagatcga
ctagacatccttatcaataatgcaggcatcatgcgttgtccatattggaaaacagaagat
ggctttgagatgcaactcggcgtcaatcacttgggccacttccttctgacaaatcttctg
ttagacatgctggaaagatctcaaccaagtcgcatcattaatgtcagttctctagcgcac
gtgagagggaagattcactttgatgatttgcaaagcgaacaagagtacagcccaagttcc
gcctactcacagagtaaacttgctaatgtcttgttcactcgcgaattgagcaaacgcctg
gaagataccgatattttagtcactgctgtacaccctggtgttgtgaaaaccgaattagct
cgtcatacaacttttgcgaagtccaaaatcgcgtctttgactctggctccgcttgcgtgg
ttgtttttcaagacttctcttcagggagcacaaacaacaatttattgcgctgtagcagat
gacgttgagtctggactgtactacagtgactgcaagcctaaggaaccagctgatcaggga
aaagatgatagagcagctaaaaagctttgggaagttagcgcagatttggttggcctagaa
aaaactacttga

KEGG   Pocillopora damicornis (lace coral): 113669473
Entry
113669473         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113669473
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113669473
SSDB
Motif
Pfam: adh_short adh_short_C2 Eno-Rase_NADH_b
Other DBs
NCBI-GeneID: 113669473
NCBI-ProteinID: XP_027041308
Position
Unknown
AA seq 238 aa
MAVQIVLISGCSSGIGLATAVFLAKDAEKRFKVYATINNAGIGLMTALECVPIQMAKELF
EVNYFGAFRLIKAVLPSMKARQSGLIINNSSHFGIVGVPFVEIYCSSKFAIEGLTESIAP
ILRQFNIRCCLLEPGPVQTSIVPKANEWCEAGADLTTLDPKTKDIMATVFSNVQSTFNTA
MQSCEEVAQIVLEIILGEKTNLRHQTNDKFGPGEIPAKLSDRTGNTSVDIISKHYLGK
NT seq 717 nt   +upstreamnt  +downstreamnt
atggccgtccaaatagtgttgatttctggctgctctagtggcattggactcgctacagct
gtgtttctcgccaaagatgccgagaaacgcttcaaggtttatgccaccattaacaatgca
ggaatcggcttaatgactgcgcttgaatgtgttcctattcaaatggctaaggaactgttt
gaagtgaattactttggagcatttaggttaatcaaggccgtgctaccaagcatgaaagcg
aggcagagtgggctgatcatcaacaacagcagtcattttggcatcgtaggagttcctttt
gtggaaatttactgctcatccaagtttgcaattgagggtctgacggaaagcatagctccc
attctgcgacagttcaacatcagatgctgcctgttggagccaggccccgtgcagactagt
attgtacccaaagcaaacgaatggtgcgaagctggggcggacttgacgaccttagatcca
aagacaaaggatataatggcaactgtattctccaacgtacaaagtaccttcaacaccgcc
atgcagagttgtgaagaagttgcgcaaattgtgcttgaaataatcttaggagaaaagaca
aatttgcgacatcaaaccaacgacaaatttggacctggtgaaatccctgccaaattatct
gatcgcacaggaaatacatcagttgatattatatcaaagcactatttgggaaaataa

KEGG   Pocillopora damicornis (lace coral): 113669495
Entry
113669495         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113669495
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113669495
SSDB
Motif
Pfam: adh_short adh_short_C2 KR GDP_Man_Dehyd Eno-Rase_NADH_b DUF1776
Other DBs
NCBI-GeneID: 113669495
NCBI-ProteinID: XP_027041334
Position
Unknown
AA seq 291 aa
MSSRQIVLISGCSSGIGLATAVFLAKDAEKRFKVYATMRNLAKKGQLEEEGKEYLGDTLV
VKQMDVCSDESVQKAVKEVLDTEGRIDVLFNNAGVSLLTILDCVPMELAKETFDINFFGT
LRLINAILPSMKARESGHIINNSSVFGVIGAPFFEVYCASKFAVEGLTESLVPTLKHFNI
RCTLLEPGPVSTSIGDNNVENTKGIDLKTADQKTQDLWVRMMERIGPAFEGKFLTPQAIA
EVVQDIILSDKGQFRYLPNEGMFSEEITARFADATGFKSVNLVAKQFFDDK
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtcttctcgccaaatcgtgttgatttcaggctgttccagtggcattggactcgcaaca
gctgtgtttctcgccaaagatgccgaaaaacgctttaaggtctatgccaccatgagaaat
cttgcgaagaaaggacaactggaggaagaaggaaaggaatatcttggagacacattggtt
gttaaacagatggacgtgtgtagtgatgagtcagtgcagaaagctgtgaaggaagtgttg
gacacagaagggagaattgatgttctttttaacaatgctggggtgtcacttctaacaatc
cttgactgtgtccccatggaattggctaaagaaacatttgatatcaacttttttgggacc
ctgcggttgataaatgcaattctcccaagcatgaaagcaagagaaagtggacacataatc
aacaacagcagtgtttttggagttattggtgccccattctttgaggtatactgtgcgtcg
aagtttgctgttgaagggctgacagaatctctggttccaactcttaagcactttaacata
agatgcactttgcttgagcctggccctgtaagcacttcaattggagacaacaatgttgaa
aataccaagggtattgacttgaaaactgctgaccaaaagacacaggacttgtgggtcaga
atgatggagagaataggtccagcttttgaaggaaagtttttaactccacaggcaatagca
gaggttgttcaagatataattctaagtgacaagggccagtttcgctatctacctaatgaa
ggaatgtttagtgaagaaattactgccagatttgctgatgctacagggtttaaatctgtg
aacctggttgccaaacagttttttgatgacaagtag

KEGG   Pocillopora damicornis (lace coral): 113669496
Entry
113669496         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113669496
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113669496
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Eno-Rase_NADH_b
Other DBs
NCBI-GeneID: 113669496
NCBI-ProteinID: XP_027041335
Position
Unknown
AA seq 291 aa
MVRQIVLISGCSSGIGLATAVFLAKDSEKRFKVYATMRNLSKKGQLVEEGKESLEDTLVI
KEMDVSSDESVQKAVEEVLDTEGRIDVLFNNAGIGGLFTALECTPLALVKELFEVNFFGS
VRLIQAVLPGMKARRSGHIINNSSHLGIVGVPFNESYCATKFAMEGLTEALAPVLLHFNI
RCTILEPGPTQTLGPENGTAFVNKFSLSDADQKSQELLGTFAGRMFSMFGSTMQTSHQVA
EYVKNIILCEKPQFRYQTNAKYRPEEIKVKLADPTGNTLVEMVKRDFLDTE
NT seq 876 nt   +upstreamnt  +downstreamnt
atggttcgccaaatcgttttgatttctggctgttccagcggcattggactcgctacagct
gtatttctcgccaaagattctgagaaacgctttaaggtctacgccaccatgaggaatctg
tcgaagaaaggacaattggtggaagaaggaaaggaatctcttgaagacacactggttatc
aaagagatggacgtgagcagtgacgaatcggtgcagaaagctgtggaggaagtgttagac
actgaagggagaattgatgtactatttaacaacgctggtattggaggtctgtttactgca
ctggaatgcacaccactcgccctggtcaaggagctgtttgaagtgaatttctttggctct
gtgcgtttgatccaagccgtgctaccaggaatgaaagcaagacgaagcggacatatcatc
aacaacagtagccatcttggtatcgtcggggtgccttttaacgagagttactgtgcaaca
aagttcgctatggagggactcacggaagctttagctccagtcttacttcatttcaacatc
aggtgtaccatactcgaaccaggccctacgcagaccctcggtcctgaaaatggcaccgcc
ttcgtcaacaaattcagtttatcagacgccgaccaaaagagtcaagaacttctgggaacc
tttgcggggagaatgttctctatgttcggaagtacaatgcaaacttctcaccaggtggca
gaatacgtgaagaatattatcctctgtgagaaaccacagtttcgataccaaacaaatgca
aaatacagacccgaggaaatcaaagtgaagcttgccgatcctacaggaaatactttagtt
gaaatggtgaagagagactttctcgacactgaataa

KEGG   Pocillopora damicornis (lace coral): 113669538
Entry
113669538         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113669538
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113669538
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Eno-Rase_NADH_b DUF1776
Other DBs
NCBI-GeneID: 113669538
NCBI-ProteinID: XP_027041391
Position
Unknown
AA seq 291 aa
MASPQIVLISGCSSGIGLATAVFLAKDAEKRFKVYATMRNLAKKGQLEEEGKEYLGDTLV
IKQMDVCSDESVQKAVKEVLDTEGRIDVLFNNAGTLVMSALECVPIKVTKELFEVNVFGA
LRLIQAVLPSMKARESGLIINNSSHHGVVGVPFVEIYSSSKFAVEGLTESMAPLLRQFNI
RCCLLQPGPVETPVRSKASDWSQESVDLTTLDAKTKSLMEAVNEYFGKILGETMQSSEEI
AQVVQEIILGQKKSLRLQTNVKYGPGEIAAKLADPTGDALISIVAKRYFNE
NT seq 876 nt   +upstreamnt  +downstreamnt
atggcttctccccaaatcgtgttgatttctggctgttctagtggcattggactcgctaca
gctgtgtttctggccaaagatgccgagaaacgcttcaaggtttatgccaccatgagaaat
ctcgcgaagaaaggacaattggaggaagaaggaaaggaatatcttggagacacactggtc
attaaacagatggatgtatgcagcgacgagtcagtgcagaaagctgtgaaggaagtgttg
gacacagagggaagaattgatgtattgtttaacaacgctggtactcttgttatgtcagcg
ctggaatgtgtccccatcaaagtcaccaaggagctatttgaagtcaacgtcttcggggca
ctgagattaatccaggccgtgttgccgagcatgaaagcgagggagagtgggctaatcatt
aataacagcagccatcacggtgttgttggagttcctttcgtggaaatttacagctcgtca
aagtttgctgtagaaggtctgacagagagtatggctccactactccgtcagtttaacata
agatgctgtctgttgcaaccaggccccgttgaaactcctgtaaggtcgaaagcgagcgac
tggagtcaagagagcgtggacttgacaaccttggacgccaagacgaaaagtttgatggaa
gcggttaatgaatattttggcaaaatactgggtgaaactatgcagagcagtgaagaaatt
gcgcaagttgtgcaggaaatcatattagggcagaaaaaaagcctacgactacaaaccaat
gtaaaatacggccccggtgaaattgctgccaaattagctgatcctacgggggacgcattg
atcagtattgtggctaaacgttattttaatgaataa

KEGG   Pocillopora damicornis (lace coral): 113674339
Entry
113674339         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113674339
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113674339
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Eno-Rase_NADH_b
Other DBs
NCBI-GeneID: 113674339
NCBI-ProteinID: XP_027046618
Position
Unknown
AA seq 290 aa
MASPRIVLISGCSTGIGLHTALHLANDAEKRFKVYATMRNLEKKTSLEEEGKERLGKTLV
IMCMDVSCDESVKSVVEEIIAKEGKIDVLVNNAGVGCVAPLECMTMEHIKQMFDVNFFGS
VRLIQAVLPGMKARQDGYIVNVSSIFGITGGPFNDMYSAAKFAMGGLTESLAPVLKQFNI
RISLVEPGPVVTSFISNLKGMVSQVDLSTADKKSIQLMQSVIATMTELTANEGQKSEEIA
ETIKEILLSAKPHIRYLTNKTYGVDEANSKLSDLTGDKLVEVLEKRFFPK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcgtcgccaaggatcgtcttaatctcaggctgttcaactggtatcggccttcacacc
gcacttcatttagctaatgatgccgaaaaacgttttaaggtgtacgcaaccatgagaaat
ctggagaaaaagacctctctggaagaggaaggaaaggaacgactcggcaaaacactggtc
attatgtgcatggatgtaagctgtgacgaatctgtgaaaagcgtggtcgaagaaatcatt
gcgaaggaagggaagatcgatgttcttgtgaacaacgccggtgttggttgtgtggcgcct
ctggaatgcatgacaatggaacacattaaacaaatgtttgacgttaatttctttggatcc
gttcgtttgatccaggctgttctcccaggcatgaaagcgaggcaggatggttacattgtt
aatgtcagcagtatttttggaataacgggtggaccatttaacgacatgtattctgcagca
aagtttgcaatgggaggattgacagagtcgctggcacctgtgttgaaacagttcaatatt
aggatctctttggttgagccaggaccggttgtcacttcgttcatcagtaacttgaagggt
atggtaagtcaagtggacctctcaaccgctgacaaaaagtcaatccagctgatgcaatct
gtgattgctacgatgacagagctgacagccaacgagggacaaaaatcagaagaaatcgct
gaaaccataaaggagatcttgctatcggccaagcctcacatccgatatctgactaacaaa
acttacggtgtagacgaggcgaattctaaattgtctgatctcaccggtgacaaactcgtt
gaggtactggaaaaaaggttctttccaaagtaa

KEGG   Pocillopora damicornis (lace coral): 113674385
Entry
113674385         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113674385
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113674385
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Eno-Rase_NADH_b
Other DBs
NCBI-GeneID: 113674385
NCBI-ProteinID: XP_027046671
Position
Unknown
AA seq 289 aa
MASFRVVLISGCSTGIGLETAVLLAKDPEKRFKVYATMRNLDKKTTLENEGKDALGDTLI
IKAMDVSSDKSVKSAVEEIIAQEGKIDDLINNAGVGCVGVLECMPMDQVKQLFEVNFFGA
LRLIQAVLPGMKARESGYIVNVSSMAGELGGPFNDIYCASKFALGGLTESLAPVLRQFKI
KISLVEPGPVGTSFFANIQNVDSSTADQKTVQLMKNWFDYIKGALGPSISQKGEEIAQCI
KEVLLSEKPHYRYLTNDKCFVEQISAKLADFSGDKLQEIMGKHCFGQNE
NT seq 870 nt   +upstreamnt  +downstreamnt
atggcttcatttcgtgtggttttaatctccggttgctccactggcattggcctagaaact
gccgtgcttttggccaaagatcccgagaaacgttttaaggtgtacgctacgatgagaaac
ctggacaaaaagacgacccttgagaatgagggaaaggatgcacttggtgatacattgatt
atcaaagccatggatgtgagctctgacaaatctgtcaaaagtgccgttgaggaaataatt
gctcaagaaggaaaaatcgatgatctcataaacaacgctggtgttggttgtgtcggtgtt
ctggagtgcatgcctatggatcaagtcaaacaattatttgaagtgaattttttcggagct
cttcgtttgatccaggctgtactccctggtatgaaagcgagggagagtgggtacattgtg
aatgtcagcagcatggctggggagttgggcggaccgtttaatgacatctactgtgcgtca
aagtttgctctgggaggactcacagagtcactggcacctgtgttaaggcagttcaaaatc
aagatctcattggtggagcccggacctgttggcacttcgttcttcgctaacatacagaac
gtagattcctccaccgctgaccaaaaaactgtccaactaatgaagaattggtttgactac
ataaagggggcacttggtccgtcaatctctcagaaaggggaggagattgcccaatgcatc
aaagaggttctcctttcagagaaacctcactatagatatctaaccaatgataaatgtttt
gttgaacagataagtgctaagctggccgatttttcaggcgataagctccaagaaataatg
ggaaaacattgcttcggtcagaatgagtga

KEGG   Pocillopora damicornis (lace coral): 113681203
Entry
113681203         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113681203
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113681203
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Eno-Rase_NADH_b MpsB
Other DBs
NCBI-GeneID: 113681203
NCBI-ProteinID: XP_027054083
Position
Unknown
AA seq 287 aa
MAEKIVLISGCSSGIGLSTAILLASDQCKRFKVYATMRNLEKKKELEERGKHILGDTLFI
RAMDVCSDDSVNAIVQELVSAHQRIDVVINNAGVGYFGPLEVQSMDSVRSIFETNFFGVL
RLTRAALPCMKSNKEGHIICVSSMGGINGVPFNGVYCASKFAVEGLCESLAPLLKTFNVR
CSVIEPGPVSTSFVANAQMTESDTHPEEVDDETKQLLNNCIKKMRGAFSTMVQTPDEIAQ
VILAALDAERPHFRYQTNKNYASSAANKLVDITGDKSMETMHQRFFS
NT seq 864 nt   +upstreamnt  +downstreamnt
atggctgaaaaaatagtactaattagcggttgttcctcgggaataggattgtctacagct
attttgctagccagtgatcaatgtaagcgtttcaaagtttatgcaacgatgcgaaatctt
gagaaaaagaaagagctggaggaacggggaaaacatatccttggagacacactcttcatt
agggctatggatgtgtgttcggatgattccgttaacgcgattgtccaagagctggtatcc
gcacatcagcgaattgatgtcgttataaacaatgcaggagttggctattttggtccactg
gaggtacaaagcatggattcggtaaggagcatattcgagaccaatttttttggagtgttg
cgtctcaccagagctgcacttccatgtatgaagtccaacaaggagggtcacatcatttgt
gtatcgagtatgggaggtatcaatggagtacccttcaatggcgtttattgtgcctcaaag
ttcgctgtagaaggtctgtgtgaatcattggctccattgctcaagacctttaatgtgaga
tgttctgtgattgaaccagggccagtatcgacatcttttgtagccaatgctcaaatgact
gaaagtgacactcaccctgaggaagtagatgatgaaacaaaacaacttctcaataactgc
attaaaaaaatgcgaggtgctttctctaccatggttcaaactccagatgagattgcccaa
gtgatcctggcagcactcgatgctgaaaggccacattttaggtatcaaactaacaagaat
tatgcatcttctgcagcaaacaagttggtggatatcacaggtgacaaatcaatggaaacg
atgcaccagcgtttcttcagttag

KEGG   Pocillopora damicornis (lace coral): 113682016
Entry
113682016         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113682016
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113682016
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Eno-Rase_NADH_b GDP_Man_Dehyd DUF1776 Glycos_transf_2 Bacillus_HBL TraG_N
Other DBs
NCBI-GeneID: 113682016
NCBI-ProteinID: XP_027054967
Position
Unknown
AA seq 322 aa
MGSAGSRRSTTVAATDAQEQQQPQVEELDEDGSPRIVFITGCSTGIGLATAVVLASDADK
RFKVYATMRNLGKKAALEEAAGKTLGESLFIKELDVCSEEAVNSLVKEIESEEGRIDVLV
NNAGQGLVSVFECIPIDKAQNLFDANFFGVMRVLKAALPGMKARKKGRIINVSSIIGVNG
HPFSEIYSASKFALEGLTESLAPTLRKFNIRCSLVEPGPVTTSFNNNAKSLREGIDSSTA
DDKTQALLQEALKEMYRTVTEHSQTAEEVAEIIKNVILSRAPHLRYQTNSQYAPGEVQAK
FSDATGDKAIDLMEKRFYPETK
NT seq 969 nt   +upstreamnt  +downstreamnt
atgggttcggcaggatcacgccgcagtaccactgtggcggcaactgatgcccaggagcag
caacagccgcaggtagaagagctagatgaggacggaagcccccgaattgtcttcatcact
ggttgctcaactggcatcggcctggcaacagcagttgttcttgcaagcgacgcagacaag
cgatttaaggtttatgccacaatgagaaatctcggaaagaaagcagctttggaagaagcc
gctgggaaaactctcggcgaatcactatttataaaagaattggacgtatgcagtgaagaa
gccgttaacagtttggtaaaagagattgagagtgaagagggaagaattgatgtgctcgtg
aacaacgcaggacaaggcctggtgagtgtatttgaatgcataccaattgacaaagcgcaa
aacctgttcgatgcaaacttctttggggtcatgcgagttctcaaagctgctttaccgggc
atgaaagcaagaaagaagggtcgcattatcaatgtgagcagtatcatcggagtgaatgga
cacccattcagtgaaatatacagcgcttctaaattcgccttggaaggcctgacggagagc
ctggctccaacactgaggaaattcaacatcaggtgttccctggttgagcctggaccagtg
acaacctcattcaacaacaatgccaagtcactgagagagggaatcgactcatccacagcg
gacgacaagacccaggccttgttacaggaggctttgaaagaaatgtaccgtactgtcact
gagcacagccagacagccgaggaagtggccgaaatcatcaaaaacgtgatactcagtaga
gcgcctcatttgcgataccaaacaaattctcagtacgcaccgggagaggtacaagccaag
ttttctgatgcgacaggagacaaagctatcgatctcatggaaaaaagattttacccggag
acaaagtag

KEGG   Pocillopora damicornis (lace coral): 113685541
Entry
113685541         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113685541
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     113685541
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 113685541
NCBI-ProteinID: XP_027058864
Position
Unknown
AA seq 336 aa
MGATKSRMVFKRKHASIRKSVQIEQEAAAPKIVLFTGHSHRMNLAIALPLAEDPLSSFKV
LVTIPSLSSSEYLEDPRVLNVLNKTLFVLPMDFESEESIKGVLREIMDNDGFIDAVVITS
NVLLSGQIETHTTDQAKTIFDVNTFFVISIIKAVLPMMKKQRDGRLIIVSNQAGVLGVPF
HGLYCASKFALEGFMESIAPECLAFNIRCSIVETSMIKGEEKTAQTIQVSIRSKMENADD
HTKKYQDSCSAKMRRQRSVKNFDLRRVTELLREIILEERPHFRYQLNKSSKDAAREKWSD
LHGDTYIFDSAEQFLCVETERLRDALDNINSVESKV
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgggggctaccaagagtagaatggtatttaaaagaaagcatgcatcgatcaggaagagt
gttcaaattgaacaagaggctgctgctccaaaaattgttctctttacaggacactcacac
agaatgaatctagcgattgctctgccgttggctgaagatccgctttcgagtttcaaagtt
ttggtcacaataccatctctctcaagtagtgaatatttagaagatccacgggtattgaat
gtgctcaataagacgctgtttgtcctcccaatggatttcgagtcggaggagtcgatcaaa
ggagtccttcgagagatcatggataatgatggatttattgatgctgtcgtcattacgtca
aacgtccttctaagcggtcaaatagagacacatactactgaccaggccaagacaatattt
gatgtgaatacgttttttgtgatcagcattataaaggccgttcttccgatgatgaaaaag
cagcgagatggtcgactcatcattgtaagcaatcaagcaggagtgcttggtgtccctttt
cacggtctctactgtgcctcgaaatttgcccttgaagggttcatggaaagtattgctcca
gaatgtcttgcattcaacatccgttgctcaattgttgaaacaagtatgataaaaggtgaa
gagaagacggcccaaacgatacaagtttctatccggtctaaaatggaaaatgctgatgac
cacaccaaaaagtatcaagattcatgttcagcgaaaatgaggagacaaaggtctgtgaaa
aactttgatttacgcagagtgactgaacttctacgggaaatcatacttgaagagagacct
catttccggtaccaacttaacaagtcgtcaaaagatgcagctagggaaaaatggagtgac
ctacacggagacacctacatcttcgactctgctgaacaatttctgtgcgttgaaacggaa
cgcctgcgggatgcattggataatataaatagtgttgagagcaaggtataa

DBGET integrated database retrieval system