KEGG   Pocillopora damicornis (lace coral): 113670374Help
Entry
113670374         CDS       T05773                                 

Definition
(RefSeq) tyramine receptor Ser-2-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113670374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pdam04030]
    113670374
G protein-coupled receptors [BR:pdam04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    113670374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 SNARE
Motif
Other DBs
NCBI-GeneID: 113670374
NCBI-ProteinID: XP_027042316
Position
Unknown
AA seq 349 aa AA seqDB search
MSINTSNLAELTEFGDDSDDVNLHIDGSCNRKVEVVFWVLYSAVGIIIFIGNSFTCIVLL
VSKRLRNIFMNIFLVSLSLWDVLMAIFVVPFYAIHCSHGCEYSLTGYCWIFRKAKDCVLL
ATTFNICAITYDRYLAVVRPLHYGAKMTKRRVIMILAGVWTAPVVVAGIRSAWHHSKINE
ELRYANKLYDTILVIVFVIFAILVLMVANVKIMKAIKTQNERERTEQGRRAVWRATYETR
KRRKGTRACVLVVFMFVLCWLPRIVYNLSYVVKPPGLASPLFLRLAFLSLYLQSSANPFI
YSFYRSEFRRAAFKLLSRRNSTNLRIHPSVDSVQHVRSQNIQDLTPSTD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaatacgagcaacttagcagaactcactgaatttggcgacgattcagatgat
gtgaacttacacatagatggttcttgcaacagaaaagtcgaagtggttttttgggtcttg
tactctgcagtaggaatcattatttttattgggaacagtttcacgtgcatcgttctgctg
gtatcgaaacggttgcgaaacatcttcatgaatatcttccttgtaagcttatcgctctgg
gatgtactgatggcgatttttgttgttccattttacgctatacattgcagccatggctgc
gagtattccttaaccggatattgttggatttttaggaaagcaaaggattgtgttcttctc
gcaacgacttttaatatatgtgctatcacgtacgatcgttatctggcggtggttcgacca
cttcattatggcgcgaaaatgacaaagcgacgtgtcatcatgattttggccggagtttgg
acggcgcccgtcgtcgtggcaggaataagaagcgcttggcaccattccaagataaacgaa
gaattgcgctacgctaacaaactttacgacaccatattagtgattgtgttcgtcatcttc
gctattcttgtactaatggtagctaatgtgaaaattatgaaggccattaaaacgcaaaac
gaacgagaacgaaccgaacaagggagacgggcagtctggagagcgacttatgaaacaaga
aaacgaagaaaaggaacaagagcttgtgtcttagttgtctttatgttcgtattatgttgg
cttccgagaattgtttacaatcttagttatgtcgtcaagccaccgggattagcgagtcct
ttgtttctaaggctggccttcctttctctttatctacagtcttccgctaatccatttatt
tactcattttatagatccgagttcagaagagccgcttttaagcttttaagcaggcggaac
tctacaaatcttagaattcacccttctgttgattcagtacaacacgtccgatctcaaaac
atacaggatttaaccccatcaacggattag

DBGET integrated database retrieval system