KEGG   Pocillopora damicornis (lace coral): 113671606Help
Entry
113671606         CDS       T05773                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44-like
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113671606
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdam04147]
    113671606
Membrane trafficking [BR:pdam04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    113671606
Exosome [BR:pdam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113671606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Calsequestrin Thioredoxin_7 OST3_OST6 Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 113671606
NCBI-ProteinID: XP_027043652
Position
Unknown
AA seq 391 aa AA seqDB search
MLRSSQMWLVCFLVAVLYFPSSFCGHVVQLTSQNFDQTLADNKLVFINFYADWCRFSQML
APVFEQASDLVHEEFPSGVVFGRVDCESEQEIAQRFHITKYPTLKMWRNAQVTRREYRGQ
RSVDAFSKFIKEQMTSRIIEFHALSDLNVDTSKRTVIAYLESKDSDNFKTYEKVAEEYRD
DCNFHVGVGDASLKERQTGENIVFRPQHVGAYGINDTWMLKSSASGCFKSACSFWFATSA
GSINFLIADGLKFSHPLHHLGKGPEDLPLVAIDSFKHMYLLPKFDDIKKPGRLKKFVKDL
HSGKLHREFHHGPDPAEQGHEEEEETTETDSPEEAGTEKETETGQGTETQKTGSGKTNSG
SGRKEQTSPPETVFKKLAPSYNRYTLLRDEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatcgtcgcagatgtggcttgtttgctttttagtggctgtactttattttccc
agctcgttttgtggtcatgtggtgcagctcacaagtcaaaatttcgatcaaacactagcc
gataataaactggttttcataaatttttacgccgattggtgtagatttagtcaaatgtta
gctccagtttttgagcaagcttctgatcttgtccatgaagaatttccgagtggggttgtg
tttggtagagtggattgtgaatcagaacaagagatagcacaacgatttcacatcactaaa
tatccaactttaaagatgtggagaaatgcacaggttacaaggagagaatacagaggtcag
agatctgtggatgctttttcaaagtttatcaaggaacagatgacaagcagaattatagaa
tttcatgctttgagtgatctcaatgttgatacttcaaaaagaactgtcatcgcttaccta
gaaagcaaagacagtgacaacttcaagacctatgaaaaagtggcagaagaatacagagat
gattgcaattttcatgttggagttggggatgcttctctcaaagaaagacagacaggagaa
aacattgtcttcaggcctcagcatgtgggtgcatatggaataaatgatacatggatgcta
aaaagctcagctagtggttgtttcaaatcagcctgttcattttggtttgctacctctgca
ggaagcatcaattttcttattgctgatgggctcaaattctctcatccactgcatcacttg
ggaaaaggacctgaggaccttcctcttgttgcaattgacagctttaaacacatgtacctg
ttaccaaagtttgatgacatcaagaaaccaggaagactcaagaagtttgttaaggatttg
cactcaggaaaactgcacagagagttccatcatggacctgacccagcagaacagggacat
gaggaagaagaggagactactgaaacagacagcccggaagaagcaggaacagagaaagaa
acagaaacaggccaaggtactgaaactcagaagacaggatcagggaaaacaaacagtgga
tctggacgaaaagaacagacctcgcctccagagactgtatttaagaaacttgccccaagt
tacaacagatacactttacttagggatgaattgtaa

DBGET integrated database retrieval system