KEGG   Pocillopora damicornis (lace coral): 113672325Help
Entry
113672325         CDS       T05773                                 

Definition
(RefSeq) cyclin-dependent-like kinase 5
  KO
K02090  cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113672325
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113672325
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     113672325
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: CMGC group
  CDK family
   113672325
Membrane trafficking [BR:pdam04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    113672325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7 APH RIO1
Motif
Other DBs
NCBI-GeneID: 113672325
NCBI-ProteinID: XP_027044400
Position
Unknown
AA seq 297 aa AA seqDB search
MQKYEKLEKIGEGTYGTVFKAKHKETHEIVALKRVRLDEDDEGIPSSALREICILKELKH
KNIVRLHDVMHSERRLTLVFEYCDQDLKKYFDSCQGDVDTAVVKSFMYQLLKGLAFCHSC
NVLHRDLKPQNLLINKDGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLMGAKLYS
TSIDMWSAGCIFAEMANGGRPLFPGNDIDDQLRRIFKILGPPSEETWPNVIKLPDYKDFS
HLQGAGAVSFAVVVPKLSAAGRDLLQKLLVLNPAHRISAEDAMRHTFFADLSPTFRA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatatgaaaaactggaaaagatcggcgaaggtacttatggaaccgttttcaaa
gcaaaacacaaagaaacgcacgagatagtggcgctgaagcgagtaaggcttgacgaagac
gatgagggtatccccagctcagctctgagagaaatttgcatcctgaaggaattgaagcac
aagaatatcgtaaggctacatgatgtaatgcatagtgaacgaaggctgacattggtattt
gagtactgtgatcaggatctcaaaaaatactttgacagctgtcagggcgatgttgacaca
gctgttgtcaagtcattcatgtatcagcttttaaagggcctagccttctgtcacagttgc
aatgtactccacagggatctgaagcctcaaaacctcctcattaataaggatggtgaactc
aagcttgcagactttggtcttgccagagcttttggcattcctgtccgttgttactcagcc
gaggtggtaacattatggtaccgtcctccagatgtcctcatgggggcaaagctctactcc
acatccatagacatgtggtctgctggctgtatttttgcagaaatggccaacgggggcaga
cctctctttcctggaaacgatatcgatgatcaactgcgacgtatttttaaaatcctagga
ccaccctctgaagaaacatggcccaatgtgatcaaacttccagattacaaggacttttcg
catcttcaaggcgccggggccgtttcgtttgctgtggttgtacccaaactgtccgctgcg
ggaagagatttgttgcagaaactcttggttcttaatccagctcacagaatatcagcggaa
gacgccatgcgtcacacgtttttcgccgacctcagcccaacgtttcgtgcctga

DBGET integrated database retrieval system