KEGG   Pocillopora damicornis (lace coral): 113673317Help
Entry
113673317         CDS       T05773                                 

Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113673317
Enzymes [BR:pdam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     113673317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 113673317
NCBI-ProteinID: XP_027045511
Position
Unknown
AA seq 485 aa AA seqDB search
MKYCSTRGKVQAESFEDVLFSGFTSDGGLYMPERIPVVDECTLQKWKSLSYMELVSEVTS
LFIPPEEIPPEELKDLITNAYAEFQHKEIVSLAAVNNFHVLELFHGKTLAFKDFSLACVG
TFMDYFLNKRRKHVITVVSTSGDTGSAAIESVRKSKWVDIIVMYPEGRCSQIQELQMTTI
LDENVHVIRGEGSSDDLDVPMKKCFSDDAFAKSNNLCVVNSINWCRIMVQTVHLLYAYLR
VCCNVGDTVKFVIPSGGLGHCTAAMCLYKMGVPLQVVCAVNENDIVHRTLSLGDFSPSGD
VRHTWSCSMDIEIPYNMERLLLLFSDMNYGRVDSLMRDFEQNKSLIIPEDLKGEMCKVLS
SASMSCDQTLKTMKECWDENKYLLCPHTAVGVKVVWDQRHASDLKTPIICVATASPAKFP
EAVRAAGIEMPPYPQLAELFTSPTRYTEMKKGEDWYQILRDMIKDISRNKHHNENNGTEN
GSEVR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactgtagcactcgaggaaaggtgcaggctgaatcatttgaggatgtgctattc
agtggctttactagtgatggtggattatacatgcctgagagaattccagttgtggatgaa
tgcacactgcaaaaatggaagagtctctcatatatggagcttgtgagtgaagtgacttct
ttgtttatccctccagaagaaataccaccggaggaattaaaagatctcattaccaacgca
tatgctgaatttcaacacaaggaaattgtgtccctggcagcggtgaacaacttccatgtg
ttagaattgtttcatggaaagacattggcatttaaagatttttctctggcatgtgttggg
acattcatggattactttctgaacaagagaaggaaacatgttattactgtagtgtcaact
tctggtgacacagggagtgctgccattgaaagtgtaaggaaatcaaagtgggttgatatc
atagtaatgtatcctgaaggacgctgcagccagattcaggaacttcaaatgacaacaatt
cttgatgagaatgtacatgtcatccgaggagaaggttcatcagatgacttagatgtgcca
atgaaaaagtgtttttcggatgatgcatttgcaaaatcaaataatctttgtgtagtaaac
tcgatcaactggtgtcgcataatggtacaaacagtacatcttctatatgcttacttgaga
gtttgttgcaatgttggagacacagtgaagtttgtaataccatcaggaggacttggacat
tgcacagctgccatgtgtctgtataaaatgggtgttcctctgcaagtggtgtgtgcagtc
aatgagaacgacattgtgcataggaccctatcattgggtgacttcagtcccagcggagat
gtgaggcatacatggtcatgttcaatggatattgagattccttataacatggaacgtcta
ctgttgctcttttctgacatgaattatggtcgtgttgattcactgatgagagactttgaa
cagaataagtcactgattatacctgaagatttaaaaggagagatgtgtaaggtcctctct
tctgcctctatgtcatgtgaccaaacacttaaaacaatgaaggaatgctgggatgagaac
aagtaccttctttgcccacatacagctgttggtgtcaaagtggtctgggaccaaagacat
gccagtgatcttaagacacccatcatatgcgtagccacagcaagtcccgccaaattcccg
gaggccgtcagggctgctggtattgaaatgccgccgtacccgcagttggccgagctattc
accagtcccacaaggtacacggaaatgaagaaaggagaggactggtatcaaatattgaga
gacatgataaaagatatctcccgtaataaacatcacaacgaaaacaatggcacagaaaat
gggagtgaagtcaggtag

DBGET integrated database retrieval system