KEGG   Pocillopora damicornis (lace coral): 113673334
Entry
113673334         CDS       T05773                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdam03036]
    113673334
Chromosome and associated proteins [BR:pdam03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    113673334
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 DUF4207
Other DBs
NCBI-GeneID: 113673334
NCBI-ProteinID: XP_027045528
Position
Unknown
AA seq 356 aa
MAVHRGYNMTEMKYKPSDTVIRRRRRQSLKIQKNIDDDVLMASAIGDVTWLQQSLYDTRK
AYSVSIEHGLAPIHLAAQNGQLECLKVMIERYKVDVNFQSASGWTPLHLAINKSTKKRGL
RCVQYLLGKGADPSRPTKAGITPVHQAASEGHVKCLQELIKSGATINAVDGNGHTPMSLA
RVWGQRECARILANQQWYLDKQQYLKEKLEREQKAKQIEEELQRLSLIRLAEGKHESQLA
YQRWLTEKGIPDIGTMYGPLSSEERKTAEEIRATQSLRPTPAPMLTESSIVVRSKTEYDN
FDGAPLFTSSRPTDHHDHDFDRKLELIPLERISASKRRKGQRTEGLRPNRSRTVVR
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcggtccaccgcgggtacaacatgactgaaatgaaatataaaccaagtgatacagtc
ataaggaggaggcgtagacaatctttaaaaatccaaaagaacatagatgatgacgtgctt
atggcttcagcgatcggtgatgtaacatggcttcaacaaagcctctatgatacgcgtaaa
gcatattctgtttccatcgaacacggtcttgctcctattcaccttgccgcacagaacgga
cagcttgaatgccttaaagtgatgatagaaagatataaagtagatgttaattttcaaagt
gcatctggatggacaccccttcatttagcaattaacaagtctaccaagaaaagaggattg
agatgtgtacaatatcttttagggaaaggtgcagatccatcaaggccaaccaaggctgga
atcactccagtgcatcaggcagcaagtgaaggccatgttaaatgcctgcaggagttgatc
aaatctggtgcgacgatcaacgctgtcgacgggaacggtcatactcctatgtctttagcg
cgtgtatggggccagagggaatgtgcacgcattttagccaatcaacagtggtatttggac
aaacaacagtatttgaaagaaaaacttgaaagggaacaaaaagccaaacagatcgaggaa
gaattgcaaagactgagccttatccgccttgcagagggtaaacacgagagtcagttagcg
tatcagcgatggctcacagagaaagggattcctgacattgggaccatgtacggacctctt
tcctccgaggagaggaagactgctgaagaaattcgagcaacgcagtcattacgtccaact
cctgcacccatgctaaccgagtcgtcaattgttgttagatcaaaaacggagtatgacaat
tttgatggcgcgccattgtttacttctagcagaccaacagatcaccatgatcacgacttt
gatagaaagcttgaattaattccactcgagagaatctctgcttccaagagaaggaaaggt
caaagaacggagggtttgcggccaaataggtctcggacggttgtaagataa

DBGET integrated database retrieval system