KEGG   Pocillopora damicornis (lace coral): 113673827Help
Entry
113673827         CDS       T05773                                 

Definition
(RefSeq) complement factor B-like
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113673827
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     113673827
Peptidases and inhibitors [BR:pdam01002]
 Serine peptidases
  Family S1: chymotrypsin family
   113673827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin VWA Sushi VWA_2 DUF1986 PE-PPE
Motif
Other DBs
NCBI-GeneID: 113673827
NCBI-ProteinID: XP_027046077
Position
Unknown
AA seq 724 aa AA seqDB search
MAFTTSLPIIGIILLIGCFTHNVITGGDVGTAEKRSKNCTNPPGIANGKVRIIRKTHAIY
SCNPGYKTIGILLIRCINSKWTGNPPTCQRDSTPLSCKTPRRIRNGDFEPHKDDYLVGTT
VKYSCDDNYRLRGSAKVTCTNEKSWSPKKLPRCIKRAKCKDPGTPKHGRRVGSLFLEGTQ
VRFSCDDGYELVGLQSLQCVPFCRSCKTVRWNGTTPACEKFDPLRGLKRVADSLREHFID
KLSWTTTDSLARAGLSSGAGGLDLVFVFDSSATVGSANFKKGVEFAKTIIDEFGISASPM
GTRVAVVTFSSTAKVVFNLQTNAMADKAEAIRTLDNLDFIAGGTATRLALNKTIEEIVPE
ARKDSKRALFLITDGRSNIGGDPSADASILRDFQKFEIYAIGVTDSVNEKELRSIASEPF
RTHVFLLKDFDDLAKLKQLITAKGNDYSECGIAGDTQLRNDDDENFGSVSGEEAKPGAWP
WQAAIYVKGNFRCGGALIKGNWVITVAHCFFYDGAVKPKDVIVRMGEHNRFKEEGAEQNI
GAKKVILHPNATRGNLNIGNDLALIRLKHAVKFSPLVRTVCLPEPTDVFYVRPRKTCVVA
GWGSSQKVSSDDLAGPPNEVLQQIQMKFVSQRDCRENATNAAAITENVVCAGDATGKKDA
CKGDSGSPLVIRRSIDDSWAVIGLSSWGDGCATKGKYGVYTRLKSHLRWIKRKTNRKSSK
KNKD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcatttactacatccttgcctataattggcatcattctcctcataggatgctttaca
cacaacgttattaccggaggagacgtagggactgccgagaagagaagtaagaactgcact
aatcctccaggaatagccaatgggaaggttagaataataagaaagacacatgcaatatac
agttgtaatcctggctataagaccattgggattctcttgatcagatgtattaatagcaag
tggactggaaatcctcccacatgtcagcgagactcgacacctctgtcgtgtaaaacaccc
agaagaatccgaaatggagattttgagccacataaagacgactacctggttggtaccact
gtcaagtattcctgtgacgacaactaccggctcagagggagtgccaaagtgacttgtacc
aacgaaaaaagctggtcacccaaaaaacttccaagatgtataaaaagagcaaagtgtaag
gatccaggtactcccaaacatggtcgccgggtcggaagtttgttcctagagggaactcaa
gtccggttttcctgtgatgacggatatgagctcgttggtcttcagtcacttcaatgcgtt
ccgttctgcagatcgtgcaagacagtaagatggaacggaacaactccagcatgcgaaaaa
tttgatcccttaagaggtttgaagagggtcgcagacagtctccgagaacatttcatcgac
aaactgagctggacgacaaccgacagtttggcacgcgcaggtttgtcctcgggagccgga
ggcctcgacttggtgttcgtgttcgacagctcagcaactgtcggtagtgcgaactttaaa
aaaggagttgaattcgccaagacaatcatcgacgagtttgggatatcggcatctcccatg
ggaacgagagttgctgttgttacatttagctcgacagctaaagtagtttttaatctgcaa
acgaacgcaatggctgacaaagcagaagctataaggactctcgacaacttagacttcatt
gccggtggcaccgctacacgccttgcattgaataagaccattgaggaaatcgttcctgag
gcccgaaaagacagcaagagggctttgttcctcataactgatggcaggtccaacatcggt
ggtgatccaagcgcagatgcttcgatactgcgtgacttccagaagtttgaaatctacgct
attggtgtaacagacagcgtgaatgaaaaggaactgcgcagtattgcttctgaacccttc
agaacgcatgtgttccttcttaaggactttgatgatttagccaagcttaaacagctgatc
acggccaaaggaaatgattacagtgaatgtggcatcgcaggagatactcagctgagaaat
gacgatgatgaaaatttcggctctgtcagtggagaggaggcgaagccaggagcctggccc
tggcaagcagctatctacgtgaagggaaatttccggtgtggtggtgcacttatcaaaggg
aactgggttataactgtggcgcactgctttttctacgatggggctgtgaaaccgaaagat
gttatcgtaaggatgggagaacacaatcgtttcaaagaagaaggtgctgagcagaatatc
ggagcaaagaaggttatcctacatccaaatgcgacccgggggaacttaaatataggaaat
gacttggctttgattcgcctaaagcacgccgtgaaattctcaccgttggtgagaactgta
tgtctcccagaacccacggatgtattctacgtcagaccacgaaaaacgtgtgtagtagcc
ggttggggatcttctcaaaaggtttcgtcggatgatttagcaggcccaccgaatgaagtc
ctgcaacaaattcaaatgaaattcgtatcccagcgcgattgccgcgaaaatgccaccaat
gccgcggcaataacagaaaacgttgtttgtgctggtgacgccacaggaaagaaagatgcc
tgtaaaggggacagcggttcaccccttgtgatcagacgttccatcgatgacagctgggcg
gtgattggtctatcgagctggggagatgggtgtgccactaaaggaaaatacggtgtgtac
acgcgactgaaaagtcatttgcgctggataaagcggaagacgaacagaaaaagtagtaag
aagaacaaagattaa

DBGET integrated database retrieval system