KEGG   Pocillopora damicornis (lace coral): 113673866
Entry
113673866         CDS       T05773                                 

Definition
(RefSeq) alcohol dehydrogenase class-3-like
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00010  Glycolysis / Gluconeogenesis
pdam00071  Fatty acid degradation
pdam00350  Tyrosine metabolism
pdam00620  Pyruvate metabolism
pdam00830  Retinol metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam01100  Metabolic pathways
pdam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113673866
   00620 Pyruvate metabolism
    113673866
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113673866
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    113673866
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113673866
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113673866
   00982 Drug metabolism - cytochrome P450
    113673866
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     113673866
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     113673866
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Other DBs
NCBI-GeneID: 113673866
NCBI-ProteinID: XP_027046122
Position
Unknown
AA seq 347 aa
MPETAGKPITCRAAVAWEANTPLVIETIEVAPPNVGEVRVKLVAAGVCHSDENFRKGHSD
DVFPGVFGHEASGIIESIGEGVRSVKPGDHVIPLLLAQCGECAFCKNSRTNFCVRGVRIR
GEMLDGTKRSTSRGKPLCQLLGVGAFSEYAVLPEIAVAKVCVEPGSSTAVWGLGGVGLSA
VMGCKAAGATRIIGIDIKPEKFQLAKELGCTECVNPKDHDKPIQQVLKEMTEGGVNYSVE
CVGNVETMRAAFEASHPILGTTVLVGIAPQGEELKINPRDCFFGRTIIGTLCGGFKGKDG
ITQLSEKYMAGTLKLDKIISHTMPLDKINEAFDLMHAGKSIRTVIHF
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgccagaaacagctggaaagcctattacatgccgcgctgctgtagcttgggaagccaac
acacctcttgtcatagaaaccatcgaggtggctccacctaacgttggagaagtacgcgtc
aagctcgtggccgctggtgtatgtcactcagacgaaaatttccggaagggacattcagac
gacgttttcccaggagtgtttggtcacgaagcaagtgggattattgaaagcattggtgaa
ggagtcagatcagtgaagcctggtgatcatgtgataccgctgctccttgctcaatgcggg
gagtgtgcattttgcaagaactcaaggactaatttttgtgtcaggggagtgcgcattaga
ggtgagatgcttgatggtacaaaacggtccacgtcccgagggaaaccgctatgtcagctt
ctgggagtcggcgcatttagcgaatacgctgtcctcccagaaatagctgttgccaaggtg
tgtgttgagcctgggtcaagcacagctgtgtggggactgggtggagttggactttccgca
gtgatgggatgtaaggctgctggggccacgagaattattggcattgatattaaaccggag
aaattccaacttgctaaagaacttggttgcactgaatgcgtcaaccctaaagatcatgac
aagcctatacaacaggtcttgaaagaaatgactgaaggaggagtgaattactcagttgaa
tgtgttggaaacgttgaaacaatgagggctgcattcgaagcgagtcaccctatccttggt
acaactgtgcttgttggaatagctcctcaaggtgaagaacttaaaataaatccaagagat
tgtttttttggaagaaccattataggaactctttgtggaggatttaaaggaaaggatggt
attacacagctttcagagaaatatatggctggaacattgaaactggataaaatcatatct
cacactatgccgctggacaaaataaatgaggcgtttgatctcatgcatgctggcaaaagc
atccgcacagtaattcacttttag

KEGG   Pocillopora damicornis (lace coral): 113675058
Entry
113675058         CDS       T05773                                 

Definition
(RefSeq) alcohol dehydrogenase class-3-like
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00010  Glycolysis / Gluconeogenesis
pdam00071  Fatty acid degradation
pdam00350  Tyrosine metabolism
pdam00620  Pyruvate metabolism
pdam00830  Retinol metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam01100  Metabolic pathways
pdam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113675058
   00620 Pyruvate metabolism
    113675058
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113675058
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    113675058
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113675058
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113675058
   00982 Drug metabolism - cytochrome P450
    113675058
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     113675058
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     113675058
SSDB
Motif
Pfam: ADH_zinc_N ADH_N 2-Hacid_dh_C Glu_dehyd_C ADH_zinc_N_2 TrkA_N
Other DBs
NCBI-GeneID: 113675058
NCBI-ProteinID: XP_027047393
Position
Unknown
AA seq 377 aa
MSGTEGKSISCLAAVAWEPKKPLVIETVEVAPPKAREVRIKILATGVCHTDSYTLGGHDS
EGVFPSVLGHEGGGIVESVGEGVTRVKPGDHVIPLYIPQCGECKFCQSPKTNLCSTIRTT
QGKGVMPDGTSRFSCKGQTLYHFMGTSTFSEYTVVAEISVAKVADNAPLEKVCLLGCGIS
TGYGAALNTAKVEPGSTTAIWGLGAVGLAVAMGCKAAGASRIIGIDLNPKKFTTAKEFGC
TEFVNPKDHNKPIQQVLIEMTDGGLDYTFECVGNVGTMRAALESCHKGWGTSVIVGVAAA
GKEISTRPFQLVTGRTWKGTAFGGWKSCDSVPKLVDEYMARKLKVDEFITHTLPLDKINE
AFDLMHDGKSIRAIVNF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtctgggacggaaggaaagtctatatcatgtcttgcagctgtagcttgggaacctaag
aagccacttgtgatagaaactgttgaggtggcacctcctaaggctagagaggtgcgcatt
aaaatccttgcaactggggtctgtcatacagacagttacacactgggtggacatgactca
gagggtgtctttccttctgttcttggccatgaaggaggtggtattgttgaaagtgttggt
gaaggagtcacaagagtcaagcctggtgatcatgttattcctctttacatacctcagtgt
ggtgagtgcaagttttgccaaagtccaaagacaaatctttgcagcacaattcgaacaact
cagggtaaaggtgtaatgcctgatggtacatcacgattttcatgcaaaggccagaccttg
tatcactttatgggtactagcacatttagtgagtacacagttgtggctgaaatatcagta
gcaaaggttgctgacaatgctccccttgagaaagtgtgtctccttgggtgtggaatttca
actggatatggtgcagctttaaacactgcaaaggtggagcctggatctactacagctatt
tggggactgggagctgttggtctggctgtggcaatgggctgtaaagcagcaggagcttca
aggataattggaattgatttaaatcccaaaaaatttactacagccaaagagtttggctgt
accgagtttgtcaatcccaaggatcacaacaagcctattcaacaggttttgatagagatg
acagatggaggcctggactacacctttgaatgtgttgggaatgttggaactatgcgtgct
gctctggaatcatgccacaagggatggggaacatccgttattgttggagttgccgctgcg
ggaaaagagatttctactagaccttttcaacttgtgacaggaagaacatggaaaggaact
gcatttggaggctggaagagctgtgacagtgttccaaaacttgtggatgaatatatggct
cgcaagttaaaggtggatgagtttatcacccatacgctaccattggacaagatcaacgag
gcgtttgaccttatgcatgatgggaaaagcattcgagcaatcgttaacttttga

DBGET integrated database retrieval system